DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18130 and txnb

DIOPT Version :10

Sequence 1:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001002461.1 Gene:txnb / 436734 ZFINID:ZDB-GENE-040718-162 Length:107 Species:Danio rerio


Alignment Length:100 Identity:27/100 - (27%)
Similarity:46/100 - (46%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DIQTDEELERFMERPG--LLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDT----- 70
            :|:.....:..::..|  |:|:|..:.|||||| .:|...|: |....:|.::...|.|.     
Zfish     4 EIEDKAAFDNALKNAGDKLVVVDFTATWCGPCQ-TIGPYFKL-LSEKPENKNVVFLKVDVDDAQD 66

  Fly    71 ITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVPKL 105
            :.||...:  ..|.:.|...|:.|:...||:..||
Zfish    67 VAALCGIS--CMPTFHFYKNGKKVDEFSGSNQSKL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 26/99 (26%)
DUF4746 234..554 CDD:435025
txnbNP_001002461.1 TRX_family 9..104 CDD:239245 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.