DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB6 and Ubx

DIOPT Version :9

Sequence 1:XP_011523029.1 Gene:HOXB6 / 3216 HGNCID:5117 Length:288 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:252 Identity:95/252 - (37%)
Similarity:119/252 - (47%) Gaps:66/252 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    79 ASGQESFLGQLPLYSS---------GYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAA 134
            |:||.:..|.:|:..|         ||.|       ..|..|...:|.:.......:||. |.|.
  Fly   141 ANGQNNPAGGMPVRPSACTPDSRVGGYLD-------TSGGSPVSHRGGSAGGNVSVSGGN-GNAG 197

Human   135 PCDYGPAPAFYREKESA-CALSGADEQP------------PFHP----------EPRKSDCAQDK 176
            ....|...|......:| |.:|||..|.            .|:|          :|.||....|.
  Fly   198 GVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDL 262

Human   177 SVFG--------ETEEQKCSTPVYPWMQRMNSCNSSSFGPSG--RRGRQTYTRYQTLELEKEFHY 231
            :.:|        ...|....:.:..|:           |.:|  ||||||||||||||||||||.
  Fly   263 TQYGGISTDMGKRYSESLAGSLLPDWL-----------GTNGLRRRGRQTYTRYQTLELEKEFHT 316

Human   232 NRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE 288
            |.|||||||||:|||||||||||||||||||||.|||  :.:..:|:   |:||||:
  Fly   317 NHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKE--IQAIKELN---EQEKQAQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB6XP_011523029.1 Homeobox 214..266 CDD:278475 48/51 (94%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 48/52 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.