DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB6 and Scr

DIOPT Version :9

Sequence 1:XP_011523029.1 Gene:HOXB6 / 3216 HGNCID:5117 Length:288 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:157 Identity:79/157 - (50%)
Similarity:96/157 - (61%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   127 GGGYGRAAPCDYGPAPAFYREKESACALSG--ADEQPPFH-PEPRKSDCAQDK-SVFGETEE--- 184
            ||....||      |.|......|...:||  .:...|.| |....||...|. :..|.::.   
  Fly   238 GGSLAAAA------AAAGLNNNHSGSGVSGGPGNVNVPMHSPGGGDSDSESDSGNEAGSSQNSGN 296

Human   185 -QKCSTPVYPWMQRMNSCNSSSFGPSG--RRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHA 246
             :|....:||||:|:: ..:|:...:|  :|.|.:||||||||||||||:|||||||||||||||
  Fly   297 GKKNPPQIYPWMKRVH-LGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 360

Human   247 LCLTERQIKIWFQNRRMKWKKESKLLS 273
            ||||||||||||||||||||||.|:.|
  Fly   361 LCLTERQIKIWFQNRRMKWKKEHKMAS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB6XP_011523029.1 Homeobox 214..266 CDD:278475 48/51 (94%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.