DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG34436

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:309 Identity:73/309 - (23%)
Similarity:126/309 - (40%) Gaps:72/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 VLEHQFVDESEAEAIESDSAD--SLPSITRGSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSA 294
            ||.....::..|:.::.:.|:  .|.:....|.||:|.:.:.|.|     |.|:|:....||:||
  Fly     9 VLSWMLANQGSAQLLDQNCAEVSRLSNDIIFSRPWMALVLLPNKT-----CSGALIHKYFVITSA 68

  Fly   295 HCFKLFNKRYTSNEVLVFLGRHNLKNWN--EEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILK 357
            .|  :||:    ...:|.||:.::|..:  ...|....|...|||..:  :.|:::.|||::.|:
  Fly    69 SC--VFNQ----ERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFY--EKSNFEHDIALLELQ 125

  Fly   358 DEVRFNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVV 422
            ::|.:...|||.|||...|..:..:.:|.....|..|.         ...||        |.|..
  Fly   126 NDVLYKAHIRPICLWLDKSDIDTQMFKRYETFRWGIDE---------KYILP--------AAKTS 173

  Fly   423 KAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGASI------YTGISGAGLFIRRNN 481
            |...:...:|..|   |:....|...|||.:.:.:.. ::|:.:      ||.|           
  Fly   174 KIKHISQVKCENA---FKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKI----------- 223

  Fly   482 RWMLRGTVSAALPAVETPDAESSHKLCCKNQYIIYADVAKFLDWITAFV 530
            |:.|.|..|..                 :::..:|.||.|::|||...:
  Fly   224 RYTLFGIQSYG-----------------ESRTCLYTDVTKYIDWIMGVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 66/276 (24%)
Tryp_SPc 258..526 CDD:214473 66/275 (24%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/273 (25%)
Tryp_SPc 40..251 CDD:214473 66/272 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.