DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG10041

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:202 Identity:43/202 - (21%)
Similarity:75/202 - (37%) Gaps:61/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 FVDESEAEAIESDS-ADSLPSIT-----------RGSWPWLAAIYVNNLTSLDFQCGGSLVSARV 289
            |...|.|:...||: .:|.|.:.           |..:|::.:|..|........|.|.::|...
  Fly    13 FAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHLCVGVILSNEF 77

  Fly   290 VISSAHCFKLFNKRYTSNEVLVFLGRHNL------------KNWNEEGSLAAPVDGIYIHPDFNS 342
            |:|:|||.    :...:.::.|..|..:|            :.|               ||.|..
  Fly    78 VLSAAHCI----QTNPTKQLYVAGGADSLNSRKQTRFFVVERRW---------------HPQFRV 123

  Fly   343 QLSSYDADIAVIIL-----KDEVRFNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQ 402
            ...:   ||||:.:     .|:|||.:.       :.:.|.:...|.:..::||.  |....:.:
  Fly   124 LGGN---DIAVLRIYPKFPLDDVRFRSI-------NFAGKPQRDSGTQASLVGWG--RVGVGKIR 176

  Fly   403 KLSSELP 409
            || .|:|
  Fly   177 KL-QEMP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 36/181 (20%)
Tryp_SPc 258..526 CDD:214473 36/180 (20%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 35/166 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.