DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG12951

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:291 Identity:59/291 - (20%)
Similarity:105/291 - (36%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 SADSLPSITRGS------WPWLAAIYVNNLTSLD--FQCGGSLVSARVVISSAHCFKLFNKRYTS 306
            :|.|:..:..|:      :|     :|.:|.|.|  ..||||::|...|:::|||   .|.|...
  Fly    23 AAPSISRVVNGTDSSVLKYP-----FVVSLRSYDGSHSCGGSIISKHFVMTAAHC---TNGRPAD 79

  Fly   307 NEVLVFLGRHNLKNWNEEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFN-TFIRPAC 370
            ...:.|    .:.|.:..|.....:..|..|.||:....:.: ||:::::::...|: ..:.|..
  Fly    80 TLSIQF----GVTNISAMGPNVVGIKKIIQHEDFDPTRQNAN-DISLLMVEEPFEFDGVSVAPVE 139

  Fly   371 LWS-GSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFR 434
            |.: ..:..:...|..|::|||..:.|..:....|..               |...|..:.||  
  Fly   140 LPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQE---------------VSLKIYSDEEC-- 187

  Fly   435 ANAHFRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRNN----RWMLRGTVSAALPA 495
            .:.|..........|.|:.       :.|....:|.||..|......    .|.::....|..|.
  Fly   188 TSRHNGQTDPKYHICGGVD-------EGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPG 245

  Fly   496 VETPDAESSHKLCCKNQYIIYADVAKFLDWI 526
            |                   |..|::::|||
  Fly   246 V-------------------YCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 55/282 (20%)
Tryp_SPc 258..526 CDD:214473 55/281 (20%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 55/283 (19%)
Tryp_SPc 30..260 CDD:238113 57/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.