DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG10587

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:273 Identity:54/273 - (19%)
Similarity:95/273 - (34%) Gaps:98/273 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNW---------NEEGSLAAPV 331
            ::|.|||:|:...:|:::|||               ||||..:.:|         |:.| :...|
  Fly    68 MNFVCGGTLLHDLIVLTAAHC---------------FLGRVKISDWLAVGGASKLNDRG-IQRQV 116

  Fly   332 DGIYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSS-------KTEYIVGERGIVI 389
            ..:....:|..  ...:.|:|::.||..::            |.|       |.:.:.|....|.
  Fly   117 KEVIKSAEFRE--DDMNMDVAILRLKKPMK------------GKSLGQLILCKKQLMPGTELRVS 167

  Fly   390 GWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAEC--------FRANAHF----RSL 442
            ||.....:....|||.              :.|..|:|...:|        :.::.||    :..
  Fly   168 GWGLTENSEFGPQKLL--------------RTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVH 218

  Fly   443 SSNRTFCAGIQA-EERDTHQSGASIYTGISGAGLFIRRNNRWMLRGTVSAALPAVETPDAESSHK 506
            .::..||||:.. ::..|..||          |..:.:|   .:.|.||..:....         
  Fly   219 LTDSMFCAGVLGKKDACTFDSG----------GPLVYKN---QVCGIVSFGIGCAS--------- 261

  Fly   507 LCCKNQYIIYADV 519
               |..|.:|.|:
  Fly   262 ---KRYYGVYTDI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 54/273 (20%)
Tryp_SPc 258..526 CDD:214473 54/273 (20%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 54/273 (20%)
Tryp_SPc 46..280 CDD:238113 54/273 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.