DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG11037

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:253 Identity:60/253 - (23%)
Similarity:94/253 - (37%) Gaps:62/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 LTSL----DFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSLAAPVDG 333
            ||:|    ||.|||:|::..:|:::||||.   .|..::|.:|..|   :.|.|::| :...|..
  Fly    77 LTALLYEDDFVCGGTLLNENIVLTAAHCFL---GRMKASEWIVAAG---ISNLNQKG-IRRHVKD 134

  Fly   334 IYIHPDFNSQLSSYDADIAVIILKDEVRFNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNR 398
            ..:...|..  ...:.|:||::||..::... |....|.|.|.|.    |...:|.||       
  Fly   135 FILSEQFRE--DDMNMDVAVVLLKTPLKAKN-IGTLSLCSVSLKP----GVELVVSGW------- 185

  Fly   399 TRDQKLSSELPGKKSTDASAP----KVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDT 459
                       |..:.....|    :.|..||:....|..|......::.:....|.:..::..|
  Fly   186 -----------GMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACT 239

  Fly   460 HQSGASI-----YTGISGAGLFIRRNNRWMLRGTVSAALPAVET------PDAESSHK 506
            ..||..:     ..||...|:           |..|...|.|.|      |..|.|.|
  Fly   240 FDSGGPLVFKKQVCGIVSFGI-----------GCASNRYPGVYTDVMYVKPFIEKSIK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 60/253 (24%)
Tryp_SPc 258..526 CDD:214473 60/253 (24%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 57/246 (23%)
Tryp_SPc 62..283 CDD:238113 57/248 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.