DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and Sems

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:93/253 - (36%) Gaps:77/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 LAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSLAA 329
            :|..|.||     |.|||:|:...:|:::||||:               .|...:.|:.:|.::.
  Fly    60 VAMRYFNN-----FICGGTLIHELIVLTAAHCFE---------------DRAEKEAWSVDGGISR 104

  Fly   330 PVD-GI------YIHPDFNSQLSSYDADIAVIIL-KDEVRFNTFIRPACLWSGSSKTEYIVGERG 386
            ..: ||      :| .....::.:.:.|:||::| :..|..|......|      .|....|:..
  Fly   105 LSEKGIRRQVKRFI-KSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLC------STALTPGQTM 162

  Fly   387 IVIGWSFDRTNRTRDQKLSSELPGKKSTDASAP----KVVKAPIVGNAECFRANAHFRSLS-SNR 446
            .|.||                  |..:.|...|    :.|..|::....|  ..|:..|:| |:.
  Fly   163 DVSGW------------------GMTNPDDEGPGHMLRTVSVPVIEKRIC--REAYRESVSISDS 207

  Fly   447 TFCAGIQA-EERDTHQSGASI-----YTGISGAGLFIRRNNRWMLRGTVSAALPAVET 498
            .|||.:.. ::..|:.||..:     ..||...|:           |..|...|.|.|
  Fly   208 MFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGI-----------GCASRRYPGVYT 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 56/253 (22%)
Tryp_SPc 258..526 CDD:214473 56/253 (22%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 56/253 (22%)
Tryp_SPc 44..265 CDD:238113 56/253 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.