DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG3650

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:262 Identity:69/262 - (26%)
Similarity:110/262 - (41%) Gaps:55/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 PSITRGSWPWLAAI--YVNNLT-SLDFQCGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRH 316
            |.|..|:...|:|:  :|.||. ...|.||||||::..|:::|||.    |.|.::.:.|..|..
  Fly    24 PRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCL----KGYQASRITVQGGVS 84

  Fly   317 NLKNWNEEGSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRFN--TFIRPACLWSGSSKTE 379
            .|    .:..:...|...:|...|:|  ||.:.|:.||.|:..:..:  |.| |.|      :.:
  Fly    85 KL----SQSGVVRRVARYFIPNGFSS--SSLNWDVGVIRLQSALTGSGITTI-PLC------QVQ 136

  Fly   380 YIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSS 444
            :..|....|.||.   |.|..:...|::|           :.|:..::....|.||.....:|::
  Fly   137 WNPGNYMRVSGWG---TTRYGNSSPSNQL-----------RTVRIQLIRKKVCQRAYQGRDTLTA 187

  Fly   445 NRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRN----NRWMLRGTVSAALPAVETPDAESSH 505
            : ||||         ...|....:|.||.|:..:..    ..|.| |..:|..|.|.|    |.|
  Fly   188 S-TFCA---------RTGGKDSCSGDSGGGVIFKNQLCGIVSWGL-GCANAQYPGVYT----SVH 237

  Fly   506 KL 507
            ::
  Fly   238 RV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 68/260 (26%)
Tryp_SPc 258..526 CDD:214473 67/259 (26%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 68/261 (26%)
Tryp_SPc 26..243 CDD:238113 68/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.