DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gd and CG3700

DIOPT Version :9

Sequence 1:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:381 Identity:80/381 - (20%)
Similarity:140/381 - (36%) Gaps:96/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TESLHVAIGEPKSSDGITSPV-------------FVDDDEDDV-----LEHQFVDESE-AEAIES 248
            ||......||.|.......||             :.|:..|.|     |:||.:..:| ....|.
  Fly    20 TEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEK 84

  Fly   249 ---------DSADSLPSITRGS------WPWLAAIYVN----NLTSLDFQCGGSLVSARVVISSA 294
                     .:..|.|.|..|:      :|::|.|..:    :.:.:::.||||:|..:.|:::|
  Fly    85 QCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAA 149

  Fly   295 HCFKL-------FNKRYTSNEVLVFLGRHNLKNWNEEGSLA-APVDGIYIHP--DFNSQLSSYDA 349
            ||.:.       .:..:.|.:.:|.||..:..:..::..:. ..|....:||  |...:...:..
  Fly   150 HCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN 214

  Fly   350 DIAVIILKDEVRFNTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPG---K 411
            |||::.|..:..||..:...||...|....    ::....||.|     |.|...||.|..   :
  Fly   215 DIALVELDRKAEFNDHVAAVCLPPDSGNDV----QQVTAAGWGF-----TADGVKSSHLLKVNLQ 270

  Fly   412 KSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGLF 476
            :.:|....|.::.                |:.:...||||..:.:.||       ..|.||..:|
  Fly   271 RFSDEVCQKRLRF----------------SIDTRTQFCAGSMSSQADT-------CNGDSGGPIF 312

  Fly   477 IRRNNRWMLRGTVSAALPAVETPDAESSHKLCCKNQYI--IYADVAKFLDWITAFV 530
            ::.           ...|.::......|:.|.|.:|.:  :|..|..:.|||.:.|
  Fly   313 VQH-----------PLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 60/293 (20%)
Tryp_SPc 258..526 CDD:214473 59/292 (20%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 62/296 (21%)
Tryp_SPc 102..353 CDD:214473 60/293 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.