DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and ATSRL1

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:NP_851101.1 Gene:ATSRL1 / 833711 AraportID:AT5G37370 Length:393 Species:Arabidopsis thaliana


Alignment Length:329 Identity:78/329 - (23%)
Similarity:111/329 - (33%) Gaps:103/329 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1527 HLHPGHSYMNGHRRSPS----------------------LRHNGSPLARSPSPRRRGHQYIHHDI 1569
            |:.|   :|.|:.|.||                      |:|..||..|:.     |..|:.: :
plant    51 HVEP---WMGGNCRGPSTAYCLLYKFFTMKLTVKQMHGLLKHTDSPYIRAV-----GFLYLRY-V 106

  Fly  1570 GFSDTVSNVVE-MVKETRHPRHGNSHPR------YPR----GSWSASTSPARSPSPSRYGGHLSR 1623
            ..:.|:....| .:|:......| |:.|      |.|    |.:...|...|.|.|. ....:|.
plant   107 ADAKTLWTWYEPYIKDDEEFSPG-SNGRMTTMGVYVRDLLLGLYYFDTLFPRIPVPV-MRQIVSN 169

  Fly  1624 SKRTQLPYPTYGTTSLCQRSRSPSPARLQEMRERDRLGYGIDMGVTHVQHSYPTLASRRAGIGRR 1688
            .::..||....|:|....|....:..|...::....:.:|         ...|..||.|.....|
plant   170 LEKMNLPTKPSGSTGDMTRGSEDTARRPPSVKASLSVSFG---------QRAPHRASTRGSSPVR 225

  Fly  1689 LPPTPSKPSTLQLKPTNINFPKLNASPTHTHHSTPHSVHSLPHHRDLLRDPRDMYYSSR--ERER 1751
            .||                       ||....:....|......|...||    |||.|  :|:|
plant   226 RPP-----------------------PTGYDRNGGDEVQQRSPRRSQSRD----YYSDRDSDRQR 263

  Fly  1752 DRERLRDRDRDRDRDRLHE--------------YD---LRYEYRD----RERELYERERDREREV 1795
            :|||.:||:|:|.|||..|              ||   .|.:|.|    .:|....|.|.|.|.|
plant   264 EREREKDRERERGRDRYRERERDYGNDRRSRRDYDSRSRRNDYEDDRSRHDRRSRSRSRSRSRSV 328

  Fly  1796 ERER 1799
            :.||
plant   329 QIER 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124
Ion_trans 441..677 CDD:334124
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
ATSRL1NP_851101.1 PRP38 4..165 CDD:397446 27/124 (22%)
PRP38_assoc 178..260 CDD:403927 22/117 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.