DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and bicdl1

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:XP_031757461.1 Gene:bicdl1 / 779781 XenbaseID:XB-GENE-5811431 Length:603 Species:Xenopus tropicalis


Alignment Length:420 Identity:77/420 - (18%)
Similarity:141/420 - (33%) Gaps:135/420 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1736 LRDPRDMYYSSRERERD-------RERLRDRDRDRDR----------DRL-------HEYDLRYE 1776
            :|:..::....|::|:|       .:.|.:|::|..|          |:|       ||...:.|
 Frog    56 VREQSELLCIIRQKEKDLVLAARLGKALLERNQDMSRRYEEMQREMTDKLEHLEQEKHELKRKLE 120

  Fly  1777 YRDRERE-----------LYERERDRE----REVERERLEYIAPLS------FEQALAMGRTGRV 1820
            .|:.|.|           |.:.|.:::    ||.:||:|..:..||      .||........|.
 Frog   121 NREGEWEGRVSELESDVKLLQEELEKQQVNLREADREKLSVVQELSEQNQRLLEQLSRATEMERQ 185

  Fly  1821 LPSPV---LNGFKPKSGLNPRHSDSDEEDWCXQRLXLRS-RNRKDQIWVXHQAICSSLSAPNLDH 1881
            |...|   ...|:.||....:|....|.... |.| ::. .:||.:                |:.
 Frog   186 LSQQVNVLQEEFREKSLSTSQHVSRLESLLAEQILEIKMLSDRKRE----------------LEQ 234

  Fly  1882 NFDTIRHSYQIPEHLQNLPYLCPPVHQHQHQHQTQTQNQRQHQDQHLYQRYGTNVSTPKLGTTIS 1946
            ...||...   .|.||.|      |.:.|.:..:..|           |.:|.::...:....|.
 Frog   235 QLSTIMEE---NEQLQGL------VEELQDKELSLNQ-----------QNFGKDLQLRESQLEIE 279

  Fly  1947 DIKLAGVSLQ------------------------ELSPNRQPQSQQKQEQQLHQDGW-------- 1979
            :::|:...|:                        |:..:.:.:.|:::.:||....|        
 Frog   280 EMRLSYRQLEGKLEELREEKSLQHMNSTSTSLLSEIEQSIEAEEQEQEREQLRLQLWEAHCQVRS 344

  Fly  1980 ----LRWYRQSGPYGSPVMASLPETRATSPHSDIEFIRTMKRSETGTTAITPRTTKTEAMILSVP 2040
                ||. .:|........:|:.|:..||...|:             .|.:.||..:|...|.:.
 Frog   345 LCCQLRG-NESADSAVSTDSSMDESSETSSAKDV-------------PAGSLRTALSELKSLILS 395

  Fly  2041 ITITSPLAIKKIYSDNDINYNTERGTDNDR 2070
            |..|...|..:...|:.:....::.:::.|
 Frog   396 ILETCDSASSRKCEDDGLEEQIKQTSEDSR 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124
Ion_trans 441..677 CDD:334124
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
bicdl1XP_031757461.1 SbcC <49..>533 CDD:223496 77/420 (18%)
SMC_prok_A <81..>300 CDD:274009 50/254 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.