DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and pitpnc1l

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:NP_001016639.1 Gene:pitpnc1l / 549393 XenbaseID:XB-GENE-5779888 Length:333 Species:Xenopus tropicalis


Alignment Length:53 Identity:14/53 - (26%)
Similarity:22/53 - (41%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITS 253
            ||||..:..|:.:.||.|..::..:.....|...|:...||........|:.|
 Frog   229 SLEDVRRFEKKLQEETNCKVNSQKKTQETCFRARNSKMSCLRPLGATKKGVVS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124 14/53 (26%)
Ion_trans 441..677 CDD:334124
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
pitpnc1lNP_001016639.1 SRPBCC 2..248 CDD:301327 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.