DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and Catsper2

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:NP_001012220.1 Gene:Catsper2 / 366174 RGDID:1307620 Length:584 Species:Rattus norvegicus


Alignment Length:417 Identity:94/417 - (22%)
Similarity:170/417 - (40%) Gaps:87/417 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GGGPTSLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKT---VLAQKL 73
            ||.|          |:..:..::::...|...::..|..|..||.:|..|.....|   .|...|
  Rat    90 GGRP----------PLSLWAGWVLDSSIFSNFIISLIFLNTFVLMVEIELMNSTNTSLWPLKLAL 144

  Fly    74 EKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGFMTQY-PQIGPEVD---L 134
            |.|:.:.|..|.||..|..||...:     :.:|.|::.||.|.:...:.:: ..||...|   |
  Rat   145 EVTDWFILLSFIVEILLMWLASFFL-----FWKNAWSVFDFVVTMLSLLPEFVVLIGVSADSVWL 204

  Fly   135 RTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTC 199
            :.||..||||.|||.:..|.::|:|.::::|:..:..:.:|:|....:||:.|:.|:......|.
  Rat   205 QLLRVSRVLRSLKLFARFPQIKVILLALVRALKSMTFLLMLLLIFFYVFAVAGVYFFKEYSRSTI 269

  Fly   200 YSLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTV 264
            .:||                 .|:.                             |.::..:::||
  Rat   270 ENLE-----------------YNMF-----------------------------FSDLLNSLVTV 288

  Fly   265 FQCITMEGWTAIL--YWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFAKEREKVENRQ 327
            |...|::.|.|:|  .|........|:.||.:..:::||....|:::.::...|...|.::....
  Rat   289 FILFTLDHWYAVLQDVWKVPEASRVFSSIYVILWLLLGSIIFRNIIVAMMVTNFQNIRNELHEEM 353

  Fly   328 EFLK------------LRRQQQLERELNGYVEWICKAEEVILAEERTTEEEKMHIMEARRRNAAK 380
            ..|:            ::|:||.| .|.|..:.  |..|.|......|:|||....|:....:.:
  Rat   354 THLEVQYKADIFKRRIIQRRQQSE-SLRGTSQG--KVSEDITETSEATDEEKSEAEESEEEKSEE 415

  Fly   381 RKKLKSLGKSKSTDTEEEEAEEDYGDD 407
            .|  ..:.||.....:||:::|:..|:
  Rat   416 EK--SDVEKSDEEKNDEEKSDEEENDE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124 68/295 (23%)
Ion_trans 441..677 CDD:334124
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
Catsper2NP_001012220.1 Ion_trans 138..348 CDD:278921 60/260 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 376..460 18/70 (26%)
HSP90 419..>463 CDD:278607 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 480..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.