DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and Catsper4

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:XP_342942.5 Gene:Catsper4 / 362623 RGDID:1565213 Length:448 Species:Rattus norvegicus


Alignment Length:372 Identity:77/372 - (20%)
Similarity:143/372 - (38%) Gaps:121/372 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQK----LEKTEAYFLCIFCVEASL 90
            |.:.::..|.|:..:...::.|.:.:||..:      :.|.||    ....:...|.|...|   
  Rat    60 YIKQLLRHPAFQLLLAFLLVTNAITIALRTN------SYLGQKHYELFSTIDDIVLTILICE--- 115

  Fly    91 KILALGLVLHKHSYLRNIWNIMDF---FVVVTGFMTQ--------YPQIGPEVDLRTLRAIRVLR 144
              :.||.:.....:.::.|||::|   |::..||..:        ||       ||.||.:.|  
  Rat   116 --VLLGWLNGFWIFWKDGWNILNFAIVFILFMGFFIKQLNETFITYP-------LRALRLVHV-- 169

  Fly   145 PLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLV 209
                ...:..|..:::.|:::|..|..:..|:||.:::|::.|:..:                  
  Rat   170 ----CMAVEPLARIIRVILQSMPDLANVMALILFFMLVFSVFGVTLF------------------ 212

  Fly   210 KEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWT 274
                               |:||..:                  |.|:|.|:.|:|.|||.:||.
  Rat   213 -------------------GAFVPKH------------------FQNMGVALYTLFICITQDGWL 240

  Fly   275 AIL--YWTND-----ALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFAKEREKVENRQEFLKL 332
            .|.  :...:     .:|.|   |||...|.:|:|..|||.:.|::          .|.::.:|.
  Rat   241 DIYMDFQVEEREYAMEVGGA---IYFAIFITLGAFIGLNLFVVVVT----------TNLEQMMKT 292

  Fly   333 RRQQQLERELNGYVEWICKAEEVILAEERTTEEEKMHIMEARRRNAA 379
            ..::       |:::.|...|:....|:.|.|...:|..|||:..:|
  Rat   293 GEEE-------GHLQPITFNEKDAEEEDWTDELPLVHCTEARKETSA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124 63/308 (20%)
Ion_trans 441..677 CDD:334124
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
Catsper4XP_342942.5 Ion_trans 91..289 CDD:278921 59/283 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.