DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and TPCN2

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:NP_620714.2 Gene:TPCN2 / 219931 HGNCID:20820 Length:752 Species:Homo sapiens


Alignment Length:701 Identity:160/701 - (22%)
Similarity:282/701 - (40%) Gaps:156/701 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 IRHTV--KTQWFY----------------WFVIVLVFLNT---------VCVAVEHYGQPSFLTE 471
            |.|.|  .:.|.|                :.::.|.|:.|         |......:..|..|||
Human    62 INHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTE 126

  Fly   472 FLYYAEFIFLGLFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSEVKGGSFGLSV-- 534
            .:   |.:.|.:|.:::.:|.|..|...:.::.:.....||:..|:  |.|      :..||:  
Human   127 SV---EVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSL--VDW------TVSLSLVC 180

  Fly   535 ---LRALRLLRIFKVTKYWSSLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLP 596
               ||..||||.|.:.:..|.::..:..:..|:..:.|:..||.:.:.:|.:.||.||.|.....
Human   181 HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAGGKQDD 245

  Fly   597 GGTPE--TNFNTFPIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLL 659
            |...|  |.|...|.:|.::..:||..:..:||....      .|...|:|:|||..:.|:..|:
Human   246 GQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAY------SKNRAYAIFFIVFTVIGSLFLM 304

  Fly   660 NVFLAI--------------------------AVDNLANAQELTAAEEEQVEEDKEKQLQELEKE 698
            |:..||                          |.:.|::......|..:.|....:..||.|:| 
Human   305 NLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQK- 368

  Fly   699 MEALQADGVHVE------NGDGAVAPSKSKGKKKEEEKKEEEEVTEGPKPMLPYSSMFILSPTNP 757
               :|.|..|.:      ...|:|..|..:.:|...| .:...|.|.| |...|.|.|:.|    
Human   369 ---VQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNE-LDRSVVKEHP-PRPEYQSPFLQS---- 424

  Fly   758 IRRGAHWVVNLPYFDFF--IMVVISMSSIA--LAAEDPVRENSRRNKILNYFDYAFTGVFTIEML 818
                |.::....|||:.  ::.:.::.||.  |..:..|....|.:.||...:..|...:.:|||
Human   425 ----AQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYYLLEML 485

  Fly   819 LKIVDLGVILHPGSYLREFWNIMDAVVVICAAV--------------SFGFDMSGSSAGQNLSTI 869
            ||:..||:    ..||....|:.|.::.:...|              .:..:|.|.     ||..
Human   486 LKVFALGL----RGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGL-----LSLW 541

  Fly   870 KSLRVLRVLRPLKTIKRVPKLK---AVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFF 931
            ...|:|.:|...:.::.:|.:|   .|...|:..::|:.....:.::..::|::||:.||.|...
Human   542 DMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIV 606

  Fly   932 YCTDESK----HTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWP 992
            .....|.    :.||.| ||:           ::|..|   |.::|:.|||::||:.:.....| 
Human   607 ALPGNSSLAPANGSAPC-GSF-----------EQLEYW---ANNFDDFAAALVTLWNLMVVNNW- 655

  Fly   993 QVLQHSMAATYEDRGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITF 1043
               |..:.|.....||..      .|:::::::|....:||:|:|||:..|
Human   656 ---QVFLDAYRRYSGPWS------KIYFVLWWLVSSVIWVNLFLALILENF 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124
Ion_trans 441..677 CDD:334124 64/293 (22%)
Ion_trans 769..1050 CDD:334124 70/300 (23%)
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
TPCN2NP_620714.2 Ion_trans <184..315 CDD:278921 39/136 (29%)
Ion_trans 468..697 CDD:278921 61/262 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.