DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and Catsper2

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:NP_694715.2 Gene:Catsper2 / 212670 MGIID:2387404 Length:588 Species:Mus musculus


Alignment Length:432 Identity:88/432 - (20%)
Similarity:172/432 - (39%) Gaps:95/432 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVL---AQKLEKTEAYFLCIFCVE 87
            |:..:..::::...|...::..|..|..||.:|..|.....|.|   ...||..:.:.|..|.||
Mouse    94 PLSLWAGWVLDSSVFSKFIISLIFLNTFVLMVEIELMESTNTALWPVKLALEVADWFILLSFIVE 158

  Fly    88 ASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGFMTQYPQI-------GPEVDLRTLRAIRVLRP 145
            ..|..||...:     :.::.||:.||||.:...:   |::       ...|.|:.||..||||.
Mouse   159 ILLMWLASFSL-----FWKDAWNVFDFFVTLLSLL---PELVVLLGVPAHSVWLQLLRVCRVLRS 215

  Fly   146 LKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLVK 210
            |||.:....::|:|.::::|:..:..:.:|:|....|||:.|:.|:......|...||       
Mouse   216 LKLFARFRQIKVILLALVRALKSMTFLLMLLLIFFYIFAVTGVYFFREYSRSTIEGLE------- 273

  Fly   211 EGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTA 275
                      .|:.                             |.::..:::|||...|::.|.|
Mouse   274 ----------YNMF-----------------------------FSDLLNSLVTVFILFTLDHWYA 299

  Fly   276 IL--YWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFAKEREKVENRQEFLKLR----- 333
            :|  .|........|:.||.:..:::||....|:::.::...|...|.::......|:::     
Mouse   300 VLQDIWKVPESSRVFSSIYVILWLLLGSIIFRNIIVAMMVTNFQNIRSELSEEMSHLEVQYKADM 364

  Fly   334 -RQQQLER-----ELNGYVEWICKAEEVILA---------------EERTTEEEKMHIMEARRRN 377
             :||.::|     .|.|  ..:.|..|.|:.               ::...:::|....|:....
Mouse   365 FKQQIIQRRQHSESLRG--TSLGKVSEDIIETSDASDDDDDDDDDDDDDDDDDDKSDATESDGEK 427

  Fly   378 AAKRKKLKSLGKSKSTDTEEEEAEEDYGDDGYLKTRSKPQGS 419
            ....:......:|:::::|:.:.|:||....| ..:|.|:.|
Mouse   428 NENEESDSENSESENSESEKIDPEKDYAKKSY-PEKSHPEKS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124 67/298 (22%)
Ion_trans 441..677 CDD:334124
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
Catsper2NP_694715.2 Ion_trans 105..350 CDD:366146 67/298 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.