DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and CATSPER2

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:NP_001269239.1 Gene:CATSPER2 / 117155 HGNCID:18810 Length:534 Species:Homo sapiens


Alignment Length:328 Identity:90/328 - (27%)
Similarity:162/328 - (49%) Gaps:40/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 WIRHTVKTQWFYWFVIVLVFLNTVCVAVEHYGQPSFLTEF------LYYAEFIFLGLFMSEMFIK 491
            |....::...|..|:|.||||||:.:.||.....|..|:.      |..|.:..|.:|:.|:.:|
Human   106 WAGWVLECPLFKNFIIFLVFLNTIILMVEIELLESTNTKLWPLKLTLEVAAWFILLIFILEILLK 170

  Fly   492 MYALGPRIYFESSFNRFDCVVISGSIFE--VIWSEVKGGSFGLSVLRALRLLRIFKVTKYWSSLR 554
             :.....::::|::|.||.||...|:..  |:...|.|.|..|.:||..|:||..|:...:..::
Human   171 -WLSNFSVFWKSAWNVFDFVVTMLSLLPEVVVLVGVTGQSVWLQLLRICRVLRSLKLLAQFRQIQ 234

  Fly   555 NLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPETN--FNTFPIALLTVFQI 617
            .:::.|:.:::|:..||.||.:|..|||:.|:.:|......|....|.:  |:..|.:|:|||.:
Human   235 IIILVLVRALKSMTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFFSDLPNSLVTVFIL 299

  Fly   618 LTGEDWNEVMYQGI-----ISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQ--- 674
            .|.:.|..:: |.:     :|:      :..|||||:.:|.|:....::.:|:.|.|..|.:   
Human   300 FTLDHWYALL-QDVWKVPEVSR------IFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKEL 357

  Fly   675 -ELTAAEEEQVEEDK-EKQLQELEKEM--EALQADGVHVENGDGAVAPSKSKGKKKEEEKKEEEE 735
             |..|..|.|::.|. ::|:.:..|.|  |||.:....:|:          :|..::.|..:..|
Human   358 NEEMARREVQLKADMFKRQIIQRRKNMSHEALTSSHSKIED----------RGASQQRESLDLSE 412

  Fly   736 VTE 738
            |:|
Human   413 VSE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124
Ion_trans 441..677 CDD:334124 73/254 (29%)
Ion_trans 769..1050 CDD:334124
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
CATSPER2NP_001269239.1 Ion_trans 178..356 CDD:278921 53/184 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.