DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cac and lig1

DIOPT Version :9

Sequence 1:NP_001356945.1 Gene:cac / 32158 FlyBaseID:FBgn0263111 Length:2110 Species:Drosophila melanogaster
Sequence 2:XP_002941929.1 Gene:lig1 / 100271763 XenbaseID:XB-GENE-1009779 Length:1040 Species:Xenopus tropicalis


Alignment Length:229 Identity:50/229 - (21%)
Similarity:83/229 - (36%) Gaps:60/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 AQELTAAEEEQVEEDKEKQLQELEKEMEALQADGVHVENGDGAVAPSKS--KGKKKEE---EKKE 732
            :.::::.::.:.:..:||..:|.||:.:..:.    |:......||.|.  |.:||||   ||..
 Frog   296 SDKVSSKDDSEGKSSEEKSDEEPEKKADPAKP----VKQISSFFAPKKPAIKTEKKEEIMNEKNA 356

  Fly   733 EEEVTE-GPKPMLPYSSMF-ILSPT--------NPIRRGAH------WV--VNLPYFDFFIMVVI 779
            .|...| .|||....||.| .:.|.        ||.:...|      |.  ..:||         
 Frog   357 SETSLEASPKPKKTVSSFFGAIKPEPSEDQAVYNPSKSSYHPINDACWSNGQKVPY--------- 412

  Fly   780 SMSSIALAAE-DPVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDA 843
                :|:|.. :.:.|.|.|.|             .||.|...:...:.|.||..|...:..::.
 Frog   413 ----LAVARTFERIEEESARLK-------------NIETLSNFLRSVIALTPGDLLPCIYLCLNR 460

  Fly   844 VVVICAAVSFGFDMS------GSSAGQNLSTIKS 871
            :......:..|...:      ..:.|:.|..|||
 Frog   461 LGPAYEGLELGIGETILMKAVAQATGRQLEKIKS 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cacNP_001356945.1 Ion_trans 37..324 CDD:334124
Ion_trans 441..677 CDD:334124 0/3 (0%)
Ion_trans 769..1050 CDD:334124 21/110 (19%)
Ion_trans 1094..1345 CDD:334124
GPHH 1346..1416 CDD:339854
Ca_chan_IQ 1418..1492 CDD:337190
lig1XP_002941929.1 PTZ00121 <157..>369 CDD:173412 21/76 (28%)
PLN03113 268..1020 CDD:215584 50/229 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.