DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sclp and LRRC20

DIOPT Version :9

Sequence 1:NP_001259475.1 Gene:Sclp / 32156 FlyBaseID:FBgn0030357 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001265140.1 Gene:LRRC20 / 55222 HGNCID:23421 Length:184 Species:Homo sapiens


Alignment Length:158 Identity:51/158 - (32%)
Similarity:88/158 - (55%) Gaps:8/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GQGVIRVVQRCEDAKE--NHKLDLSSCELMQIPDAVYHLMRNT----ELITCNLSGNVLKSVSPK 134
            |:.|.||.::..:..|  :..|||:.|:|:..|..:|.::||.    .|||  |:.|.|||::.|
Human     6 GEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLIT--LANNELKSLTSK 68

  Fly   135 FSQKFSTITDLNLSHNKLSRLPEEFASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAIL 199
            |...||.:.:|:|..|.|.|||.|.::|..|..:::|.|.|...|:.:..|.:|.:::.:.|.|:
Human    69 FMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIV 133

  Fly   200 EIDTDEAITSDNLALVDLRNNPLSRNCR 227
            ::..::......|..::||.|||:...|
Human   134 DVPVEKLAAMPALRSINLRFNPLNAEVR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SclpNP_001259475.1 LRR_RI 77..>232 CDD:238064 50/157 (32%)
LRR_8 93..152 CDD:290566 24/62 (39%)
leucine-rich repeat 93..115 CDD:275380 7/21 (33%)
leucine-rich repeat 116..141 CDD:275380 11/28 (39%)
LRR_8 140..198 CDD:290566 18/57 (32%)
leucine-rich repeat 142..164 CDD:275380 9/21 (43%)
leucine-rich repeat 165..187 CDD:275380 6/21 (29%)
leucine-rich repeat 188..211 CDD:275380 3/22 (14%)
LRRC20NP_001265140.1 PRK15370 <7..>184 CDD:185268 50/157 (32%)
leucine-rich repeat 26..47 CDD:275380 7/20 (35%)
LRR 1 51..72 10/22 (45%)
PPP1R42 <74..161 CDD:411060 25/86 (29%)
LRR 2 75..96 8/20 (40%)
leucine-rich repeat 76..98 CDD:275378 9/21 (43%)
LRR 3 98..120 5/21 (24%)
leucine-rich repeat 99..121 CDD:275378 6/21 (29%)
LRR 4 121..141 3/19 (16%)
leucine-rich repeat 122..145 CDD:275378 3/22 (14%)
LRR 5 145..167 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159781
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1291630at2759
OrthoFinder 1 1.000 - - FOG0007270
OrthoInspector 1 1.000 - - oto90622
orthoMCL 1 0.900 - - OOG6_108515
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3858
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.640

Return to query results.
Submit another query.