DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sclp and CG11099

DIOPT Version :10

Sequence 1:NP_001259475.1 Gene:Sclp / 32156 FlyBaseID:FBgn0030357 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_611457.1 Gene:CG11099 / 37282 FlyBaseID:FBgn0034485 Length:378 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:63/131 - (48%) Gaps:12/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LDLSSCELMQIPDAVYHLMRNTELITCNLSGNVLKSVSPKFSQKFSTITDLNLSHNKLSRLPEEF 159
            :.|:...|.::|..:| ::.|.|.:  ::|.|.||.:.|......: :..||:|.|:|:.||.|.
  Fly    52 IHLAGNNLSELPVDIY-MLENLEFL--DVSNNELKELPPTLGLLLN-LQQLNVSGNQLTELPVEL 112

  Fly   160 ASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAIL--------EIDTDEAITSDNLALVD 216
            :.|..|..|||..|.|..||..:.:...|..|:..:|..|        .:...:::.:|..|||.
  Fly   113 SGLRNLEHLNIGKNQFRRLPVQLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVY 177

  Fly   217 L 217
            |
  Fly   178 L 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SclpNP_001259475.1 LRR <93..>223 CDD:443914 37/131 (28%)
leucine-rich repeat 93..115 CDD:275380 4/19 (21%)
leucine-rich repeat 116..141 CDD:275380 6/24 (25%)
leucine-rich repeat 142..164 CDD:275380 9/21 (43%)
leucine-rich repeat 165..187 CDD:275380 8/21 (38%)
leucine-rich repeat 188..211 CDD:275380 4/30 (13%)
CG11099NP_611457.1 leucine-rich repeat 4..25 CDD:275380
LRR <19..>179 CDD:443914 37/131 (28%)
leucine-rich repeat 26..48 CDD:275380
leucine-rich repeat 49..71 CDD:275380 4/19 (21%)
leucine-rich repeat 72..95 CDD:275380 6/25 (24%)
leucine-rich repeat 96..117 CDD:275380 9/20 (45%)
leucine-rich repeat 118..140 CDD:275380 8/21 (38%)
leucine-rich repeat 141..164 CDD:275380 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.