DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sclp and SPBC887.09c

DIOPT Version :9

Sequence 1:NP_001259475.1 Gene:Sclp / 32156 FlyBaseID:FBgn0030357 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_596483.1 Gene:SPBC887.09c / 2541171 PomBaseID:SPBC887.09c Length:886 Species:Schizosaccharomyces pombe


Alignment Length:214 Identity:58/214 - (27%)
Similarity:88/214 - (41%) Gaps:39/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RVVQRCEDA-KENH-KLDLSSCELMQIPDAVYHLMRNTE--LITCNLSGNVLKSVSPKFSQKFST 141
            |:::..||| .||. .||||...|.::|   |..:...:  :....|..|.:||:.|:. .||:.
pombe    16 RIIKEAEDAGPENALTLDLSHLNLRELP---YEQLERIQGRIARLALGHNFIKSIGPEI-LKFTR 76

  Fly   142 ITDLNLSHNKLSRLPEEFASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAILEIDTDEA 206
            :..||:..|.|...||....|.:|..|:||.|....||:....|.:|..|....|.:.|:.|..|
pombe    77 LRYLNIRSNVLREFPESLCRLESLEILDISRNKIKQLPESFGALMNLKVLSISKNRLFELPTYIA 141

  Fly   207 ITSDNLALVDLRNNPLSRNCRRKLQSFKTPFHLEISKDVEDDWFLTKSREITRWDSHLGFGNFSN 271
             ...||.::.:.||.:         .|..| |: .:.|::|.            |..|...|...
pombe   142 -HMPNLEILKIENNHI---------VFPPP-HI-ANNDLQDS------------DMQLFIANIKG 182

  Fly   272 YDS-------TRKRGTANS 283
            |.|       ||...|.::
pombe   183 YLSRNESVFRTRSESTVSA 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SclpNP_001259475.1 LRR_RI 77..>232 CDD:238064 45/154 (29%)
LRR_8 93..152 CDD:290566 17/61 (28%)
leucine-rich repeat 93..115 CDD:275380 7/22 (32%)
leucine-rich repeat 116..141 CDD:275380 7/26 (27%)
LRR_8 140..198 CDD:290566 18/57 (32%)
leucine-rich repeat 142..164 CDD:275380 7/21 (33%)
leucine-rich repeat 165..187 CDD:275380 8/21 (38%)
leucine-rich repeat 188..211 CDD:275380 6/22 (27%)
SPBC887.09cNP_596483.1 leucine-rich repeat 31..53 CDD:275380 7/24 (29%)
LRR_8 53..110 CDD:290566 19/57 (33%)
leucine-rich repeat 54..76 CDD:275380 7/22 (32%)
LRR_4 75..115 CDD:289563 13/39 (33%)
leucine-rich repeat 77..99 CDD:275380 7/21 (33%)
LRR_8 99..156 CDD:290566 18/57 (32%)
leucine-rich repeat 100..122 CDD:275380 8/21 (38%)
leucine-rich repeat 123..145 CDD:275380 6/22 (27%)
SOG2 505..812 CDD:287409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.