Sequence 1: | NP_001259475.1 | Gene: | Sclp / 32156 | FlyBaseID: | FBgn0030357 | Length: | 339 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_596483.1 | Gene: | SPBC887.09c / 2541171 | PomBaseID: | SPBC887.09c | Length: | 886 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 214 | Identity: | 58/214 - (27%) |
---|---|---|---|
Similarity: | 88/214 - (41%) | Gaps: | 39/214 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 RVVQRCEDA-KENH-KLDLSSCELMQIPDAVYHLMRNTE--LITCNLSGNVLKSVSPKFSQKFST 141
Fly 142 ITDLNLSHNKLSRLPEEFASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAILEIDTDEA 206
Fly 207 ITSDNLALVDLRNNPLSRNCRRKLQSFKTPFHLEISKDVEDDWFLTKSREITRWDSHLGFGNFSN 271
Fly 272 YDS-------TRKRGTANS 283 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sclp | NP_001259475.1 | LRR_RI | 77..>232 | CDD:238064 | 45/154 (29%) |
LRR_8 | 93..152 | CDD:290566 | 17/61 (28%) | ||
leucine-rich repeat | 93..115 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 116..141 | CDD:275380 | 7/26 (27%) | ||
LRR_8 | 140..198 | CDD:290566 | 18/57 (32%) | ||
leucine-rich repeat | 142..164 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 165..187 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 188..211 | CDD:275380 | 6/22 (27%) | ||
SPBC887.09c | NP_596483.1 | leucine-rich repeat | 31..53 | CDD:275380 | 7/24 (29%) |
LRR_8 | 53..110 | CDD:290566 | 19/57 (33%) | ||
leucine-rich repeat | 54..76 | CDD:275380 | 7/22 (32%) | ||
LRR_4 | 75..115 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 77..99 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 99..156 | CDD:290566 | 18/57 (32%) | ||
leucine-rich repeat | 100..122 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 123..145 | CDD:275380 | 6/22 (27%) | ||
SOG2 | 505..812 | CDD:287409 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16083 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |