DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sclp and K08E7.8

DIOPT Version :9

Sequence 1:NP_001259475.1 Gene:Sclp / 32156 FlyBaseID:FBgn0030357 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001040969.1 Gene:K08E7.8 / 178213 WormBaseID:WBGene00010675 Length:176 Species:Caenorhabditis elegans


Alignment Length:170 Identity:67/170 - (39%)
Similarity:100/170 - (58%) Gaps:5/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 AGQGVIRVVQRCEDAKENHKLDLSSCELMQIPDAVYHLMRNTELITCNLSGNVLKSVSPKFSQKF 139
            ||:||.:||:|||.|||:..||||||:||.:.||||.|::..|:...::..|..|....||..||
 Worm     7 AGKGVTQVVERCEAAKESGFLDLSSCQLMYMADAVYMLIKGYEITKVSIQDNGFKKFPKKFVIKF 71

  Fly   140 STITDLNLSHNKLSRLPEEFASLSALTKLNISNNSFIVLPQVVFKLQSLASLDAQNNAILEIDTD 204
            .|.|.||:::|::|.:|||.|:.::|..||.:.|.....|:...:|::|..||...|.:.|||.|
 Worm    72 PTATILNMANNEISEIPEEVATWTSLKGLNAAKNKISKFPEPFLQLKNLIYLDLNGNQLEEIDVD 136

  Fly   205 EAITSDNLALVDLR---NNPLSRNCRRKLQSFKTPFHLEI 241
             ...|...||:.|.   |..|....::||::.| |..|::
 Worm   137 -LFYSSLPALIKLNLSGNEGLGDETKKKLKALK-PEKLDL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SclpNP_001259475.1 LRR_RI 77..>232 CDD:238064 62/157 (39%)
LRR_8 93..152 CDD:290566 25/58 (43%)
leucine-rich repeat 93..115 CDD:275380 13/21 (62%)
leucine-rich repeat 116..141 CDD:275380 7/24 (29%)
LRR_8 140..198 CDD:290566 20/57 (35%)
leucine-rich repeat 142..164 CDD:275380 9/21 (43%)
leucine-rich repeat 165..187 CDD:275380 6/21 (29%)
leucine-rich repeat 188..211 CDD:275380 9/22 (41%)
K08E7.8NP_001040969.1 leucine-rich repeat 50..73 CDD:275378 6/22 (27%)
leucine-rich repeat 74..96 CDD:275378 9/21 (43%)
LRR_RI <76..174 CDD:238064 33/99 (33%)
LRR_8 95..153 CDD:290566 18/58 (31%)
leucine-rich repeat 97..119 CDD:275378 6/21 (29%)
leucine-rich repeat 120..144 CDD:275378 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H44023
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1291630at2759
OrthoFinder 1 1.000 - - FOG0007270
OrthoInspector 1 1.000 - - oto18111
orthoMCL 1 0.900 - - OOG6_108515
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3858
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.