DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upf1 and CT55

DIOPT Version :9

Sequence 1:NP_001285145.1 Gene:Upf1 / 32153 FlyBaseID:FBgn0030354 Length:1180 Species:Drosophila melanogaster
Sequence 2:NP_001026875.1 Gene:CT55 / 54967 HGNCID:26047 Length:264 Species:Homo sapiens


Alignment Length:285 Identity:56/285 - (19%)
Similarity:102/285 - (35%) Gaps:83/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 YEKTFGPLVRLEAEYDQKLKESATQ----ENIEVRW--DVGLNKKTIAYFTLAKTDSDMKLMHGD 337
            |.:|..|..| :....|.|.:..||    :.:...:  |.|:..::| ||:......::.|..|.
Human    12 YGRTADPAER-QGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESI-YFSSDVVTGNVPLKVGQ 74

  Fly   338 ELRL-------HYVGELYNPWSEIG-HVIKVPDNFGDDVGLEL------KSSTNAPVKCTSNFTV 388
            ::.:       ||           | ..|||     |.|...|      .|.|...:.|.::...
Human    75 KVNVVVEEDKPHY-----------GLRAIKV-----DVVPRHLYGAGPSDSGTRVLIGCVTSINE 123

  Fly   389 DFIWKCTSFDRMTRALCKFAIDRNSVSNFIYSRLLGHGRADSNDEVLFRGP--QPKLFSAPHLPD 451
            |.|:                     :||.||..:    ...|.|.|.::|.  :.:..:.|.:.:
Human   124 DNIY---------------------ISNSIYFSI----AIVSEDFVPYKGDLLEVEYSTEPGISN 163

  Fly   452 LNRSQVYAVK--HALQRPLSLIQGPPGTGKTVTSATIVYQL--VKLHGGTVLVCAPSNTAVDQLT 512
            :..:.|..::  |..:..::.:.|..|    |...||.:.|  |||..|          .|.|:.
Human   164 IKATSVKPIRCIHTEEVCITSVHGRNG----VIDYTIFFTLDSVKLPDG----------YVPQVD 214

  Fly   513 EKIHRTNLKVVRVCAKSREAIDSPV 537
            :.::...::.::.|...|....:||
Human   215 DIVNVVMVESIQFCFIWRAISITPV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Upf1NP_001285145.1 UPF1_Zn_bind 98..249 CDD:286500
DNA2 122..897 CDD:224037 56/285 (20%)
Mis12 210..299 CDD:283509 6/19 (32%)
AAA_19 458..>515 CDD:289986 13/60 (22%)
AAA_12 661..857 CDD:289832
CT55NP_001026875.1 S1-like 41..>78 CDD:316926 7/37 (19%)
S1-like 182..233 CDD:316926 13/64 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.