DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upf1 and F53E10.5

DIOPT Version :9

Sequence 1:NP_001285145.1 Gene:Upf1 / 32153 FlyBaseID:FBgn0030354 Length:1180 Species:Drosophila melanogaster
Sequence 2:NP_503712.2 Gene:F53E10.5 / 186167 WormBaseID:WBGene00018761 Length:460 Species:Caenorhabditis elegans


Alignment Length:199 Identity:43/199 - (21%)
Similarity:69/199 - (34%) Gaps:78/199 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 EKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSSADEKRYR 577
            ||..|.|    .:..:::|.|:          .::.|.|.:| |.|..||:..   :..|||...
 Worm   302 EKARRIN----EITEENKENIE----------HLQKMSTTAE-KLLNDLKNNK---APNDEKGKM 348

  Fly   578 NLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVLGAKQLILVG 642
            .:|                   |....|.:|.|          ||.|.:.:...:          
 Worm   349 TIK-------------------GTKGSRKTRAK----------QSAESKTLAYKI---------- 374

  Fly   643 DHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSQFPSNFFYEGSLQNGVC 707
               :||.|.:.|..|   :|::|.:  :...:..|.||         :..|:|:|||..|.    
 Worm   375 ---RLGEVEIEKFQA---ISETLEQ--IAKNVAQFVLE---------NGIPANYFYERPLH---- 418

  Fly   708 AEDR 711
            .|||
 Worm   419 TEDR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Upf1NP_001285145.1 UPF1_Zn_bind 98..249 CDD:286500
DNA2 122..897 CDD:224037 43/199 (22%)
Mis12 210..299 CDD:283509
AAA_19 458..>515 CDD:289986 1/1 (100%)
AAA_12 661..857 CDD:289832 14/51 (27%)
F53E10.5NP_503712.2 CwlO1 217..374 CDD:226400 24/118 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.