Sequence 1: | NP_001285145.1 | Gene: | Upf1 / 32153 | FlyBaseID: | FBgn0030354 | Length: | 1180 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503712.2 | Gene: | F53E10.5 / 186167 | WormBaseID: | WBGene00018761 | Length: | 460 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 43/199 - (21%) |
---|---|---|---|
Similarity: | 69/199 - (34%) | Gaps: | 78/199 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 513 EKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSSADEKRYR 577
Fly 578 NLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVPVVLGAKQLILVG 642
Fly 643 DHCQLGPVVMCKKAARAGLSQSLFERLVVLGIRPFRLEVQYRMHPELSQFPSNFFYEGSLQNGVC 707
Fly 708 AEDR 711 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Upf1 | NP_001285145.1 | UPF1_Zn_bind | 98..249 | CDD:286500 | |
DNA2 | 122..897 | CDD:224037 | 43/199 (22%) | ||
Mis12 | 210..299 | CDD:283509 | |||
AAA_19 | 458..>515 | CDD:289986 | 1/1 (100%) | ||
AAA_12 | 661..857 | CDD:289832 | 14/51 (27%) | ||
F53E10.5 | NP_503712.2 | CwlO1 | 217..374 | CDD:226400 | 24/118 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1112 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |