DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wisp and HESO1

DIOPT Version :9

Sequence 1:NP_001285144.1 Gene:wisp / 32152 FlyBaseID:FBgn0260780 Length:1373 Species:Drosophila melanogaster
Sequence 2:NP_001318386.1 Gene:HESO1 / 818559 AraportID:AT2G39740 Length:511 Species:Arabidopsis thaliana


Alignment Length:377 Identity:101/377 - (26%)
Similarity:165/377 - (43%) Gaps:80/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1014 CLVGSTITGFGTDSS---------DIDMCLLPEQGVHPHQHQYHQHHHFHNEKRTEALIILTLFN 1069
            ||.|:|:..||:..|         ||.:.|.....:           .|..:|:.:.|:...|  
plant    44 CLRGATVQPFGSFVSNLFTRWGDLDISVDLFSGSSI-----------LFTGKKQKQTLLGHLL-- 95

  Fly  1070 AVLKDTEVFQDFN-LIEARVPILRFKDISNGIEVDLNFNNCVGIKNTYLLQLYAQMDWRTRPLVV 1133
            ..|:.:.::.... :|.||||||:.......|..|::.:|..|:..:..|...:::|.|.|.||:
plant    96 RALRASGLWYKLQFVIHARVPILKVVSGHQRISCDISIDNLDGLLKSRFLFWISEIDGRFRDLVL 160

  Fly  1134 IVKLWAQYHDINDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYPE-------------KF 1185
            :||.||:.|:|||:|..|.:||||.|:|:.:.| .|||.:||.|..:||:             :.
plant   161 LVKEWAKAHNINDSKTGTFNSYSLSLLVIFHFQ-TCVPAILPPLRVIYPKSAVDDLTGVRKTAEE 224

  Fly  1186 QLGQQDCLDLDLIEPIEPYQALNTQTLGEHLLGFFKYYSTFDFRNFAISIRTGGVLPVSTCRMAK 1250
            .:.|....::...:. |..:::|..:|.|.|:.||..:|..:     :..:..||.|. |.|...
plant   225 SIAQVTAANIARFKS-ERAKSVNRSSLSELLVSFFAKFSDIN-----VKAQEFGVCPF-TGRWET 282

  Fly  1251 SPKNDVYQWK--ELNIEEPFDLS-NTARSVYDGPTFERVKAVFLISARRL--------------- 1297
            ...|..:..|  .|.:|:||:.. |.|||| .....:|:..||.|::|||               
plant   283 ISSNTTWLPKTYSLFVEDPFEQPVNAARSV-SRRNLDRIAQVFQITSRRLVSECNRNSIIGILTG 346

  Fly  1298 DHTLDLATIFRPIHHVPEHF---------------PQLQQHQQQFEQQLHHP 1334
            .|..:  :::|.|....:|.               ||.||.||.:.|..:.|
plant   347 QHIQE--SLYRTISLPSQHHANGMHNVRNLHGQARPQNQQMQQNWSQSYNTP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wispNP_001285144.1 NT_PAP_TUTase 987..1122 CDD:143392 27/117 (23%)
PAP_assoc 1211..1272 CDD:281779 17/63 (27%)
HESO1NP_001318386.1 TRF4 11..436 CDD:227585 101/377 (27%)
Pro-rich <372..507 CDD:373673 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001361
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12271
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.