DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wisp and T08B2.4

DIOPT Version :10

Sequence 1:NP_572766.1 Gene:wisp / 32152 FlyBaseID:FBgn0260780 Length:1373 Species:Drosophila melanogaster
Sequence 2:NP_491797.1 Gene:T08B2.4 / 188273 WormBaseID:WBGene00020345 Length:119 Species:Caenorhabditis elegans


Alignment Length:99 Identity:18/99 - (18%)
Similarity:35/99 - (35%) Gaps:32/99 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 NVYQQYQHQQQHHAQQHTHPHFRRKHSDNGSGINKKMHYSPPGKSGDPADRSASGQQQHHHPHQQ 541
            :||:..|...:|..:..|               :::|             ||.|....|..||: 
 Worm    33 SVYEYIQSCMEHSKKVFT---------------DRRM-------------RSESSPTTHLQPHR- 68

  Fly   542 QKTIEILASSHFNAMHRRMQGGNNKNGYYQHSYN 575
               |.:|:.:.:.::..|.:...|:...|..:.|
 Worm    69 ---IMVLSRNRYESIGLRGKFFKNQKKCYSKNCN 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wispNP_572766.1 TRF4 <1017..>1290 CDD:227585
T08B2.4NP_491797.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.