DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wisp and C53A5.2

DIOPT Version :9

Sequence 1:NP_001285144.1 Gene:wisp / 32152 FlyBaseID:FBgn0260780 Length:1373 Species:Drosophila melanogaster
Sequence 2:NP_506597.2 Gene:C53A5.2 / 179957 WormBaseID:WBGene00008263 Length:86 Species:Caenorhabditis elegans


Alignment Length:44 Identity:11/44 - (25%)
Similarity:15/44 - (34%) Gaps:16/44 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QCHLKFGKYNNKTANLLRQVNSCHSSNSSSNTSNNNNEAIKGQQ 98
            :||......  |.|:.||:...|.|              .:|||
 Worm    52 ECHWYCDSI--KGASFLRRCKDCLS--------------FRGQQ 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wispNP_001285144.1 NT_PAP_TUTase 987..1122 CDD:143392
PAP_assoc 1211..1272 CDD:281779
C53A5.2NP_506597.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.