Sequence 1: | NP_001285144.1 | Gene: | wisp / 32152 | FlyBaseID: | FBgn0260780 | Length: | 1373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256592.1 | Gene: | C53A5.17 / 13216595 | WormBaseID: | WBGene00194707 | Length: | 474 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 40/204 - (19%) |
---|---|---|---|
Similarity: | 71/204 - (34%) | Gaps: | 69/204 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1124 MDWRTRPLVVIVKLWAQYHDINDAKRMTISSYSLVLMV-LHYLQHACVPHVLPC--LHSLYPEKF 1185
Fly 1186 QLGQ------QDC----------------LDLDLIEPIEPYQALNTQTLGEHLLGFFKYY----- 1223
Fly 1224 --------STFDFRNFAISIRTG---GVLPVSTCRMAKSPK----NDV----YQWKELNI----- 1264
Fly 1265 -EEPFDLSN 1272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wisp | NP_001285144.1 | NT_PAP_TUTase | 987..1122 | CDD:143392 | |
PAP_assoc | 1211..1272 | CDD:281779 | 17/90 (19%) | ||
C53A5.17 | NP_001256592.1 | Met_10 | 144..363 | CDD:280612 | 28/161 (17%) |
AdoMet_MTases | 268..>311 | CDD:302624 | 8/34 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5260 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |