DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sicily and Fdft1

DIOPT Version :9

Sequence 1:NP_001285142.1 Gene:sicily / 32151 FlyBaseID:FBgn0030352 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_062111.1 Gene:Fdft1 / 29580 RGDID:61834 Length:416 Species:Rattus norvegicus


Alignment Length:324 Identity:67/324 - (20%)
Similarity:109/324 - (33%) Gaps:119/324 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTNAIPREKKVIEADKNGY--GAKHCMSLVEKYDYENYLCTLLLPRELRRAA----FALRAFN-V 90
            :.|.||:      .|:|..  ..|.|...:::...........|..::|.|.    ..|||.: |
  Rat    24 RRNFIPK------MDRNSLSNSLKTCYKYLDQTSRSFAAVIQALDGDIRHAVCVFYLILRAMDTV 82

  Fly    91 EVSRSVSGHQIEPQIAKMRLKFWHDSIDKCFEP--------DSQRSYVED--------------- 132
            |...::|   :|.:|..:|  .:|..:   :||        :..|..:||               
  Rat    83 EDDMAIS---VEKKIPLLR--NFHTFL---YEPEWRFTESKEKHRVVLEDFPTISLEFRNLAEKY 139

  Fly   133 QPVLRELKHTVG---SRKLNK--------------------VYLRRLVTARERPPTHAFESIREL 174
            |.|:.::.|.:|   :..|||                    :.|.||.:|.|      ||. ..:
  Rat   140 QTVIADICHRMGCGMAEFLNKDVTSKQDWDKYCHYVAGLVGIGLSRLFSASE------FED-PIV 197

  Fly   175 EEYTEQTFSSLLLLLLEVGGVRDLNADHAASHLGKAQGIATLLRSIPLAGRQQAPCIPLEVLVLH 239
            .|.|| ..:|:.|.|.:...:||...|..                   .|||   ..|.||...:
  Rat   198 GEDTE-CANSMGLFLQKTNIIRDYLEDQQ-------------------EGRQ---FWPQEVWGKY 239

  Fly   240 GVSQERIIRSKSDDKGVEDCIFDVASAANTHLKLARQLHDKVPPQVRKIFLSAVATDAYLERLR 303
            ....|..::.::.|..|: |:.::.:.|..|:           |.|          ..||.|||
  Rat   240 VKKLEDFVKPENVDVAVK-CLNELITNALQHI-----------PDV----------ITYLSRLR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sicilyNP_001285142.1 SQS_PSY 60..312 CDD:278896 60/295 (20%)
Fdft1NP_062111.1 Isoprenoid_Biosyn_C1 39..370 CDD:412224 62/303 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.