DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sicily and ndufaf6

DIOPT Version :9

Sequence 1:NP_001285142.1 Gene:sicily / 32151 FlyBaseID:FBgn0030352 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_002931576.2 Gene:ndufaf6 / 100135115 XenbaseID:XB-GENE-980144 Length:301 Species:Xenopus tropicalis


Alignment Length:287 Identity:118/287 - (41%)
Similarity:172/287 - (59%) Gaps:17/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NGYGAKHCMSLVEKYDYENYLCTLLLPRELRRAAFALRAFNVEVSR---SVSGHQIEPQIAKMRL 110
            :|..|.:|:.||.|.|||.:|||||||:|.:.:.|||||.|||:|:   |||    :..:..||:
 Frog    22 SGQAAGYCVELVRKRDYEGFLCTLLLPQESQNSVFALRALNVELSQVKDSVS----QKSLGLMRM 82

  Fly   111 KFWHDSIDKCFEPDSQRSYVEDQPVLRELKHTVGSRKLNKVYLRRLVTARERP-PTHAFESIREL 174
            :||.|::.     |..:......||...|...|...:|.|.:..|::.|||:. ....:.:|:||
 Frog    83 QFWRDAVQ-----DIYKETPPHHPVALALSQAVQRHRLTKRWFMRMIDAREQNLDDRTYRNIQEL 142

  Fly   175 EEYTEQTFSSLLLLLLEVGGVRDLNADHAASHLGKAQGIATLLRSIPLAGRQQAPCIPLEVLVLH 239
            |.|.|.|.||||.|:||..|::|:.|||||||:||||||.|.:|::|....::...:|:::.:||
 Frog   143 ETYAENTQSSLLYLILETLGIKDVQADHAASHIGKAQGIITCMRAVPYHSSRRQVFLPIDICMLH 207

  Fly   240 GVSQERIIRSKSDDKGVEDCIFDVASAANTHLKLARQLHDKVPPQVRKIFLSAVATDAYLERLRR 304
            ..|||..||. |.:|.|:|.|||:||.|:.||:.||....::|......|...||.|.:|:.||:
 Frog   208 RASQEDFIRG-SLEKNVKDVIFDIASQAHVHLEHARSFKKRIPKSAFPAFNITVALDWHLKTLRK 271

  Fly   305 ANFLLTHKSCVGRDTLLPARLF---WK 328
            |:|.:.|.|...::||||..|:   ||
 Frog   272 ADFNIFHPSLQRKNTLLPLSLYVRSWK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sicilyNP_001285142.1 SQS_PSY 60..312 CDD:278896 105/255 (41%)
ndufaf6XP_002931576.2 SQS_PSY 33..279 CDD:395397 105/255 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 169 1.000 Domainoid score I3769
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H43831
Inparanoid 1 1.050 180 1.000 Inparanoid score I3893
OMA 1 1.010 - - QHG63146
OrthoDB 1 1.010 - - D488635at33208
OrthoFinder 1 1.000 - - FOG0006635
OrthoInspector 1 1.000 - - oto103443
Panther 1 1.100 - - LDO PTHR21181
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5635
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.