DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1840 and Selenok

DIOPT Version :9

Sequence 1:NP_572764.1 Gene:CG1840 / 32150 FlyBaseID:FBgn0030351 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_064363.2 Gene:Selenok / 80795 MGIID:1931466 Length:94 Species:Mus musculus


Alignment Length:125 Identity:36/125 - (28%)
Similarity:46/125 - (36%) Gaps:44/125 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYVDQNGRLWEKR---PWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNGDNSRRGNGWGSS 62
            |.|: .||::.:.|   ||.:..:.|.|.||        |.|:..|.......|..:| .|:|||
Mouse     1 MVYI-SNGQVLDSRNQSPWRVSFLTDFFWGI--------AEFVVFFFKTLLQQDVKKR-RGYGSS 55

  Fly    63 SWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRRIGRI-------PPPSQSCNAGG 115
            |......|.|..|                    .|.||:|||       |||.    |||
Mouse    56 SDSRYDDGRGPPG--------------------NPPRRMGRISHLRGPSPPPM----AGG 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1840NP_572764.1 DUF2763 2..>65 CDD:287875 20/65 (31%)
SelenokNP_064363.2 DUF2763 2..91 CDD:287875 33/122 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..94 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16875
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.