DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1840 and SelG

DIOPT Version :9

Sequence 1:NP_572764.1 Gene:CG1840 / 32150 FlyBaseID:FBgn0030351 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_572763.3 Gene:SelG / 32149 FlyBaseID:FBgn0030350 Length:110 Species:Drosophila melanogaster


Alignment Length:120 Identity:81/120 - (67%)
Similarity:91/120 - (75%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYVDQNGRLWEKRPWDLRRVLDTFVGIWFAVKQLLASFLSPFTGNDSNGDNSRRGNGWGSSSWG 65
            |.|:|.|||:|||||||.||:::.|||||||:|||..:||:||||| :|..|.||||||      
  Fly     1 MVYIDHNGRVWEKRPWDWRRIVELFVGIWFAIKQLFLTFLAPFTGN-NNQANPRRGNGW------ 58

  Fly    66 GGGGGGGGGGGGGGGGGGGGGGSGYRGGGLRPNRRIGRIPPPSQSCN--AGGCCG 118
            |||||.|||||||||||||..|||  .|||||||||||| .|:.|||  |||. |
  Fly    59 GGGGGWGGGGGGGGGGGGGRPGSG--SGGLRPNRRIGRI-QPTMSCNMPAGGGUG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1840NP_572764.1 DUF2763 2..>65 CDD:287875 39/62 (63%)
SelGNP_572763.3 DUF2763 2..>65 CDD:287875 44/69 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28796
OrthoDB 1 1.010 - - D1583096at2759
OrthoFinder 1 1.000 - - FOG0020054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16875
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13741
76.960

Return to query results.
Submit another query.