DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and Antp

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:356 Identity:111/356 - (31%)
Similarity:141/356 - (39%) Gaps:107/356 - (30%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSYFVNSF------SGRYP-NG----PDYQLLNYGSGSSLSGSYRDPAAMHTGSYG----YNYN 50
            |:|||.||:      .|.|| ||    ...|:.:|...::..|:...|   ....|.    ||..
  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYP---RFPPYDRMPYYNGQ 72

Human    51 GMDLS-----VNRSSASSSHFGAV---GESSRAFPAPAQEPRFRQAAS-----SCSLSSPESL-- 100
            |||..     .:|..:.||..|.|   .:::.....|.|:.:.:|..|     ..:..:|:.|  
  Fly    73 GMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQ 137

Human   101 ---PCTNGDSH-----------------------GAKPSASSPS--DQATSASSSANFT------ 131
               ..|...:|                       |..|...||.  ||.:....:|..|      
  Fly   138 QLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMG 202

Human   132 --------------EIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAP------------- 169
                          ::.|...:........|.|......|.|:.|......|             
  Fly   203 HPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTP 267

Human   170 ---------EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRI 225
                     .|....::||||    |......:.||.|..|||||||||||||||||||||||||
  Fly   268 PSQNPNSQSSGMPSPLYPWMR----SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRI 328

Human   226 EIAHALCLSERQIKIWFQNRRMKWKKDNKLK 256
            ||||||||:|||||||||||||||||:||.|
  Fly   329 EIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 25/183 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 24/172 (14%)
Antp-type hexapeptide 176..181 2/4 (50%)
Homeobox 198..251 CDD:395001 49/52 (94%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 25/148 (17%)
Homeobox 301..354 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.