Sequence 1: | NP_002138.1 | Gene: | HOXB5 / 3215 | HGNCID: | 5116 | Length: | 269 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477498.1 | Gene: | ftz / 40834 | FlyBaseID: | FBgn0001077 | Length: | 410 | Species: | Drosophila melanogaster |
Alignment Length: | 232 | Identity: | 87/232 - (37%) |
---|---|---|---|
Similarity: | 108/232 - (46%) | Gaps: | 53/232 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 68 AVGESSRAFPAPAQE--------PRFRQAASSCSLSSPES--LPCTNGDSHGAKPSASSPSDQAT 122
Human 123 SASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISH 187
Human 188 DMTG--PDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK 250
Human 251 KDNKLKS------------------MSLATAGSAFQP 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXB5 | NP_002138.1 | PRK07003 | <67..>171 | CDD:235906 | 24/112 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 77..173 | 22/105 (21%) | |||
Antp-type hexapeptide | 176..181 | 2/4 (50%) | |||
Homeobox | 198..251 | CDD:395001 | 45/52 (87%) | ||
ftz | NP_477498.1 | FTZ | 1..248 | CDD:281812 | 29/131 (22%) |
Homeobox | 257..310 | CDD:278475 | 45/52 (87%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |