DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and ftz

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:232 Identity:87/232 - (37%)
Similarity:108/232 - (46%) Gaps:53/232 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    68 AVGESSRAFPAPAQE--------PRFRQAASSCSLSSPES--LPCTNGDSHGAKPSASSPSDQAT 122
            ||.....|.|||:.:        |...:......:.||:|  ....|||.  |.|..::|     
  Fly   139 AVSTKVTASPAPSYDQEYVTVPTPSASEDVDYLDVYSPQSQTQKLKNGDF--ATPPPTTP----- 196

Human   123 SASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISH 187
                    |.:......|.|.::..:.||.::::.....:.|   ||.|...  |.|.   ||..
  Fly   197 --------TSLPPLEGISTPPQSPGEKSSSAVSQEINHRIVT---APNGAGD--FNWS---HIEE 245

Human   188 DMTG--PDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK 250
            .:..  .|.||.|..||||||||||||||||||:||||||:||:||.||||||||||||||||.|
  Fly   246 TLASDCKDSKRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSK 310

Human   251 KDNKLKS------------------MSLATAGSAFQP 269
            ||..|.|                  .|.||.|:...|
  Fly   311 KDRTLDSSPEHCGAGYTAMLPPLEATSTATTGAPSVP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 24/112 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 22/105 (21%)
Antp-type hexapeptide 176..181 2/4 (50%)
Homeobox 198..251 CDD:395001 45/52 (87%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 29/131 (22%)
Homeobox 257..310 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.