DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and Scr

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:386 Identity:122/386 - (31%)
Similarity:163/386 - (42%) Gaps:129/386 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSSY-FVNSFSGRYPNGPDYQLLNYGSGSSLSG-------------------------------- 32
            |||| ||||.:..||...:.|..:.|:|:|.:|                                
  Fly     8 MSSYQFVNSLASCYPQQMNPQQNHPGAGNSSAGGSGGGAGGSGGVVPSGGTNGGQGSAGAATPGA 72

Human    33 -SYRDPAAMHT---------------GSYG-------YNYNGMD-----LSVNRSSASSSH---F 66
             .|...||.:|               .:||       .:|..:.     |...:......|   .
  Fly    73 NDYFPAAAAYTPNLYPNTPQAHYANQAAYGGQGNPDMVDYTQLQPQRLLLQQQQQQQQQQHAHAA 137

Human    67 GAVGESSRAFPA----PAQEPRFRQAASSCSLSSPESLPCTNGDSHGA--------KPSASSPSD 119
            .||....:...|    |.|:.:.:||..||..::.   |.|.|.|.|.        ..||:|.::
  Fly   138 AAVAAQQQQQLAQQQHPQQQQQQQQANISCKYAND---PVTPGGSGGGGVSGSNNNNNSANSNNN 199

Human   120 QATSASSSANFTEID---EASASSEPEEAASQLS----SPSLARAQ-----------------PE 160
            .:.|.:|..:.:..|   :.|.||..|..|..|:    ..|||.|.                 |.
  Fly   200 NSQSLASPQDLSTRDISPKLSPSSVVESVARSLNKGVLGGSLAAAAAAAGLNNNHSGSGVSGGPG 264

Human   161 PMATSTAAPEG------------------------QTPQIFPWMRKLHISHDMTGPDG--KRART 199
            .:.....:|.|                        ..|||:|||:::|:.......:|  ||.||
  Fly   265 NVNVPMHSPGGGDSDSESDSGNEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRT 329

Human   200 AYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSL 260
            :|||||||||||||||||||||||||||||||||:|||||||||||||||||::|:.||::
  Fly   330 SYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 32/139 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 31/155 (20%)
Antp-type hexapeptide 176..181 3/4 (75%)
Homeobox 198..251 CDD:395001 50/52 (96%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 50/52 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5853
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40809
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4748
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.