DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and pb

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:193 Identity:65/193 - (33%)
Similarity:88/193 - (45%) Gaps:58/193 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   116 SPSDQATSASSSANFTEIDEASASSEPE--EAASQLS--SPSLARAQPEPMATSTAA-------- 168
            :|:....||.::...|..:....:|:|.  |..:.||  ||.:.    .|:.:....        
  Fly    79 TPNCDKRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKIG----TPVGSGAIGGVGVNVNV 139

Human   169 --------PEGQTPQI---------FPWMRKLHISHDMTG-------------PDG---KRARTA 200
                    |.|..||.         :|||::...|...:.             |:.   :|.|||
  Fly   140 NVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTA 204

Human   201 YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK---------DNK 254
            ||..|.||||||||||:||.|.||||||.:|.|:|||:|:||||||||.|:         |||
  Fly   205 YTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 13/74 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 14/76 (18%)
Antp-type hexapeptide 176..181 2/13 (15%)
Homeobox 198..251 CDD:395001 39/52 (75%)
pbNP_476669.3 COG5576 168..274 CDD:227863 47/100 (47%)
Homeobox 202..254 CDD:278475 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.