DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and lab

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:314 Identity:79/314 - (25%)
Similarity:112/314 - (35%) Gaps:118/314 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    30 LSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGES--------SRAFPAPAQEPRFR 86
            |:|||...|....|.:.:.::|:         ...|.|.:..:        .:....|.|:|:..
  Fly   271 LAGSYALDAMDSLGMHAHMHHGL---------PHGHLGNLANNPHQQQPQVQQQQQQPHQQPQHP 326

Human    87 QAASSCSLS-------SPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEE 144
            |..|..:..       ||..  ..|....|...|..|.:..:||||:.|:              .
  Fly   327 QNQSPAAHQQHHQNSVSPNG--GMNRQQRGGVISPGSSTSSSTSASNGAH--------------P 375

Human   145 AASQLSSPSLARAQP--EPMATSTAAPEGQTPQI-FPWMRKLHISHDMTG--------------- 191
            |::|..||:.:.:.|  :.|......|:.|.|:: ...:..:| .:.|.|               
  Fly   376 ASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMH-DYQMNGQLDMCRGGGGGGSGV 439

Human   192 --------------------------------------PDG---------------------KRA 197
                                                  |:|                     ...
  Fly   440 GNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVGLGSGSGLSSCSLSSNTNNSG 504

Human   198 RTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK 251
            ||.:|..|..||||||||||||||.||||||:.|.|:|.|:||||||||||.||
  Fly   505 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKK 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 24/120 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 23/104 (22%)
Antp-type hexapeptide 176..181 0/5 (0%)
Homeobox 198..251 CDD:395001 38/52 (73%)
labNP_476613.1 Homeobox 505..557 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.