DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXB5 and inv

DIOPT Version :9

Sequence 1:NP_002138.1 Gene:HOXB5 / 3215 HGNCID:5116 Length:269 Species:Homo sapiens
Sequence 2:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster


Alignment Length:278 Identity:75/278 - (26%)
Similarity:112/278 - (40%) Gaps:88/278 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    23 NYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEP---R 84
            |.| |.|:|||          |.|.:.|..:.:.|||...:             |..:.:|   .
  Fly   302 NIG-GGSVSGS----------STGSSKNSGNTNGNRSPLKA-------------PKKSGKPLNLA 342

Human    85 FRQAASSCSLSSPESLP--CTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEEAAS 147
            ...||::.|||...||.  |:|          |:.|:...::||:.|        .|..|.:.  
  Fly   343 QSNAAANSSLSFSSSLANICSN----------SNDSNSTATSSSTTN--------TSGAPVDL-- 387

Human   148 QLSSPSLARAQPEPMATSTAAPEGQTPQIFP-WM--------------------RKLHISHDMTG 191
             :.||..|.......|:..:..:..||.::| |:                    :|...|....|
  Fly   388 -VKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAG 451

Human   192 -----------------PDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK 239
                             |:.||.|||::..|...|:.||:.|||||.:||.:::..|.|:|.|||
  Fly   452 GGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIK 516

Human   240 IWFQNRRMKWKKDNKLKS 257
            |||||:|.|.||.:..|:
  Fly   517 IWFQNKRAKLKKSSGTKN 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXB5NP_002138.1 PRK07003 <67..>171 CDD:235906 22/108 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..173 22/100 (22%)
Antp-type hexapeptide 176..181 2/25 (8%)
Homeobox 198..251 CDD:395001 27/52 (52%)
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.