DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SelG and Selenok

DIOPT Version :9

Sequence 1:NP_572763.3 Gene:SelG / 32149 FlyBaseID:FBgn0030350 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_064363.2 Gene:Selenok / 80795 MGIID:1931466 Length:94 Species:Mus musculus


Alignment Length:117 Identity:35/117 - (29%)
Similarity:44/117 - (37%) Gaps:31/117 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYIDHNGRVWEKR---PWDWRRIVELFVGIWFAIKQLFLTFLAPFTGNNNQANPRRGNGWGGGG 62
            ||||. ||:|.:.|   ||....:.:.|.||...:...|.|.|      ......||        
Mouse     1 MVYIS-NGQVLDSRNQSPWRVSFLTDFFWGIAEFVVFFFKTLL------QQDVKKRR-------- 50

  Fly    63 GWGGGGGGGGGGGGGRPGSGSGGLRPNRRIGRIQ----PTMSCNMPAGGGUG 110
            |:|.........|.|.||:      |.||:|||.    |:..   |..|| |
Mouse    51 GYGSSSDSRYDDGRGPPGN------PPRRMGRISHLRGPSPP---PMAGGUG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SelGNP_572763.3 DUF2763 2..>65 CDD:287875 18/65 (28%)
SelenokNP_064363.2 DUF2763 2..91 CDD:287875 31/112 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..94 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16875
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.