DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SelG and AgaP_AGAP000358

DIOPT Version :9

Sequence 1:NP_572763.3 Gene:SelG / 32149 FlyBaseID:FBgn0030350 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_001237299.3 Gene:AgaP_AGAP000358 / 4576172 VectorBaseID:AGAP000358 Length:93 Species:Anopheles gambiae


Alignment Length:108 Identity:46/108 - (42%)
Similarity:51/108 - (47%) Gaps:16/108 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYIDHNGRVWEKRPWDWRRIVELFVGIWFAIKQLFLTFLAPFTGNNNQANPRRGNGWGGGGGWG 65
            ||||..||.|.|.:||...||..|.:|.:..:...|.|.| .|.|         |.|.||.....
Mosquito     1 MVYISRNGAVQEAQPWGVDRIKGLIMGFFNFLVMFFRTML-DFQG---------GGGSGGRDTTR 55

  Fly    66 GGGGGGGGGGGGRPGSGSGGLRPNRR-IGRIQPTMSCNMPAGG 107
            |.||.|||||||.||.|     |.|| |||......|.:|.||
Mosquito    56 GYGGSGGGGGGGPPGGG-----PRRRPIGRPMTLSDCTIPGGG 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SelGNP_572763.3 DUF2763 2..>65 CDD:287875 22/62 (35%)
AgaP_AGAP000358XP_001237299.3 DUF2763 2..>43 CDD:287875 16/41 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E0K0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28796
OrthoDB 1 1.010 - - D1583096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16875
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13741
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.