DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SelG and Y41E3.8

DIOPT Version :9

Sequence 1:NP_572763.3 Gene:SelG / 32149 FlyBaseID:FBgn0030350 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_502815.1 Gene:Y41E3.8 / 178417 WormBaseID:WBGene00012766 Length:110 Species:Caenorhabditis elegans


Alignment Length:123 Identity:49/123 - (39%)
Similarity:58/123 - (47%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYIDHNGRVWEKRPWDWRRIVELFVGIWFAIKQLF---LTFLAPFTGNNNQANPR---RGNGWG 59
            |||||.:|.|.||:.   :.|||:.||.:..|...|   |.|.:|...|:|..:.|   ||.|..
 Worm     1 MVYIDKDGNVLEKKQ---KGIVEMIVGFFTFIMLFFRSLLGFTSPTNRNSNSQDYRNIVRGGGVN 62

  Fly    60 GGGGWGG----GGGGGGGGG---GGRPGSGSGGLRPNRRIGRIQPTMSCNMPAGGGUG 110
            |.||.|.    .||||||||   ||.|  .|.|:.|        |.|......|||.|
 Worm    63 GAGGGGNAYRRNGGGGGGGGRNIGGLP--TSSGVAP--------PPMGGGCCGGGGCG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SelGNP_572763.3 DUF2763 2..>65 CDD:287875 27/68 (40%)
Y41E3.8NP_502815.1 DUF2763 2..>54 CDD:287875 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E0K0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28796
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16875
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.