DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10352 and AT5G36790

DIOPT Version :9

Sequence 1:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001119318.1 Gene:AT5G36790 / 833646 AraportID:AT5G36790 Length:362 Species:Arabidopsis thaliana


Alignment Length:307 Identity:86/307 - (28%)
Similarity:139/307 - (45%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DEFFDSFDLVFCDCDGVVWYPLRDFIPGSAEALAHLAHLGKDVTFVTNNSISSVKEHIEKFEKQG 80
            |:..||.:....|||||:|...: .|.|..|.|..|...||.:.||||||..|.|::.:|||..|
plant    73 DQLIDSVETFIFDCDGVIWKGDK-LIEGVPETLDMLRAKGKRLVFVTNNSTKSRKQYGKKFETLG 136

  Fly    81 HLKIDEHQIVHPAQTICDHLRSIKF-----------EGLIYCLATSPF----------KEILVNA 124
             |.::|.:|...:.....:|:||.|           ||::..|..:.|          ::|.:..
plant   137 -LNVNEEEIFASSFAAAAYLQSINFPKDKKVYVIGEEGILKELELAGFQYLGGPDDGKRQIELKP 200

  Fly   125 GFRLAQENGSGIITRLKDLHEAIFSGESVDAVIIDVD--FNLSAAKLMRAHFQLQ--------NP 179
            ||.:..::                   .|.||::..|  ||         ::::|        ||
plant   201 GFLMEHDH-------------------DVGAVVVGFDRYFN---------YYKIQYGTLCIRENP 237

  Fly   180 KCLFLAGAADALIPFGKG-EIIGPGAFIDVVTQAVGRQPITLGKPGEDLRKLLLERHREIPPSRV 243
            .|||:|...||:...... |..|.|:.:..:..:..|:|:.:|||...:...|.::. .|..|::
plant   238 GCLFIATNRDAVTHLTDAQEWAGGGSMVGALVGSTQREPLVVGKPSTFMMDYLADKF-GIQKSQI 301

  Fly   244 LFVGDSLASDIGFARASGYQTLLVLTGGTKLEDVQRLPIDHSQMPDY 290
            ..|||.|.:||.|.:..|.:|||||:|.|.:..::. | ::...||:
plant   302 CMVGDRLDTDILFGQNGGCKTLLVLSGVTSISMLES-P-ENKIQPDF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 83/300 (28%)
Hydrolase_6 25..127 CDD:290083 38/122 (31%)
Hydrolase_like 220..293 CDD:289983 24/71 (34%)
AT5G36790NP_001119318.1 PLN02645 56..362 CDD:178251 86/307 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4144
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.