DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10352 and zgc:77375

DIOPT Version :9

Sequence 1:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_991194.1 Gene:zgc:77375 / 402927 ZFINID:ZDB-GENE-040426-1827 Length:429 Species:Danio rerio


Alignment Length:291 Identity:68/291 - (23%)
Similarity:108/291 - (37%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SFDLVFCDCDGVVWYPLRDF--IPGSAEALAHLAHL-GK---DVTFVTN--NSISSVKEHIEKFE 77
            ||.|:| |.|||:   :|..  ||.:..|...|... |:   .|.||||  |.:..     :|.:
Zfish    31 SFGLLF-DIDGVL---VRGKTPIPAAKRAFQKLVDTKGQFLVPVVFVTNAGNCLRQ-----KKAD 86

  Fly    78 KQGHL---KIDEHQIVHPAQTICDH--LRSIK--FEGLIYCLATSPFKEILVNAGFR-------- 127
            :..|:   .|.:.|:      :..|  ||..|  .:..:......|..:|..|.||.        
Zfish    87 QLSHILGVPISQDQV------MMSHSPLRMFKKYHDKFVLVSGQGPVLDIAKNVGFTNVVSIDML 145

  Fly   128 --------LAQEN-----GSGIITRLKDLHEAIFSGESVD-----AVIIDV---DFNLSAAKLMR 171
                    :...|     .|..:..|..:...:..||.:.     .:|:||   :.|||:|....
Zfish   146 RESFPLLDMVDHNRRPKLPSSPVANLPRVEAVVLFGEPIRWETNLQLIVDVLLTNGNLSSAYETA 210

  Fly   172 AHFQLQNPKC-LFLAGAADALIP-FGKGEIIGPGAFIDVVTQAVGRQ---PITLGKPGE------ 225
            ....|....| :.|...|:|..| ||.|..:  .....:..:..|::   ...:|||.|      
Zfish   211 HSTHLPLLACNMDLMWMAEAHSPRFGHGTFM--VCLESIYKKITGKELKYEALMGKPSELTYHFA 273

  Fly   226 --DLRKLLLERHREIPPSRVLFVGDSLASDI 254
              .:|:..:||....|...:..:||:|.:||
Zfish   274 EFLIREQAVERGWRAPIRSLYAIGDNLMTDI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 66/289 (23%)
Hydrolase_6 25..127 CDD:290083 29/116 (25%)
Hydrolase_like 220..293 CDD:289983 13/43 (30%)
zgc:77375NP_991194.1 Hydrolase_6 34..137 CDD:290083 30/117 (26%)
HAD-SF-IIA 35..310 CDD:273637 65/287 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.