DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10352 and CG15739

DIOPT Version :9

Sequence 1:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster


Alignment Length:300 Identity:132/300 - (44%)
Similarity:194/300 - (64%) Gaps:4/300 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSVKYLKNMTEKERDEFFDSFDLVFCDCDGVVWYPLRDFIPGSAEALAHLAHLGKDVTFVTNNS 65
            |:..:::..:::::|....||||.|..|.|||:| .....||.:|:..|.|..:||.:||:||||
  Fly     1 MAKPQHILQLSQEQRSSVVDSFDRVVSDIDGVLW-TFEQSIPRAADGYAALEQMGKHLTFLTNNS 64

  Fly    66 ISSVKEHIEKFEKQGHLKIDEHQIVHPAQTICDHLRSIKFEGLIYCLATSPFKEILVNAGFRLAQ 130
            :.:.::.::.|.|.| :::...||.|||::|..:|:|||||||||.:|:..||.:|..|||:|..
  Fly    65 VRTSEQCVKLFAKIG-MQVHPEQIWHPAKSIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLLD 128

  Fly   131 ENGSGIITRLKDLHEAIFSGESVDAVIIDVDFNLSAAKLMRAHFQLQNPKCLFLAGAADALIPFG 195
            .....|......|.|.||..|.|.||||||||||::.|::|||..|::|:|:.:.||.|.|:|..
  Fly   129 GPNEFIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVA 193

  Fly   196 KG-EIIGPGAFIDVVTQAVGRQPITLGKPGEDLRKLLLERHREIPPSRVLFVGDSLASDIGFARA 259
            |. .|:|||||..::.:|.|:|||||||||.:|..||:|.::.:.|||||.:||.||.|:.|.|.
  Fly   194 KEVNIVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQ 258

  Fly   260 SGYQTLLVLTGGTKLEDVQRLPIDHSQMPDYLADCLGQIA 299
            .|:||||||:||...|:: ....|..::|||.||.:..:|
  Fly   259 CGFQTLLVLSGGCSKEEL-LAETDPQRIPDYYADSVADVA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 126/273 (46%)
Hydrolase_6 25..127 CDD:290083 44/101 (44%)
Hydrolase_like 220..293 CDD:289983 35/72 (49%)
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 126/275 (46%)
Hydrolase_6 25..125 CDD:290083 44/101 (44%)
Hydrolase_like 219..295 CDD:289983 37/76 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454087
Domainoid 1 1.000 54 1.000 Domainoid score I4144
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26206
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 1 1.000 - - FOG0014304
OrthoInspector 1 1.000 - - otm51381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.