DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10352 and nipsnap1

DIOPT Version :9

Sequence 1:NP_001259468.1 Gene:CG10352 / 32147 FlyBaseID:FBgn0030348 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_571108.2 Gene:nipsnap1 / 30231 ZFINID:ZDB-GENE-991008-17 Length:279 Species:Danio rerio


Alignment Length:37 Identity:9/37 - (24%)
Similarity:16/37 - (43%) Gaps:4/37 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 ARASGYQTLLVLTGGTKLEDVQRLPIDHSQMPDYLAD 293
            ||...:..||.....:.|..:|    .|:..|:|:.:
Zfish    49 ARKDAHSNLLSKKETSNLYKIQ----FHNVKPEYMEE 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10352NP_001259468.1 PGP_euk 23..296 CDD:273635 9/37 (24%)
Hydrolase_6 25..127 CDD:290083
Hydrolase_like 220..293 CDD:289983 9/35 (26%)
nipsnap1NP_571108.2 NIPSNAP 180..277 CDD:285252
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.