DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and PHO13

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_010045.1 Gene:PHO13 / 851362 SGDID:S000002395 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:77/302 - (25%)
Similarity:136/302 - (45%) Gaps:26/302 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVK 73
            :::||    .:|.:|..:.|.|||||...|::|...:....|:|:||.|.|:||||.::.....|
Yeast    15 EIAQE----FLDKYDTFLFDCDGVLWLGSQALPYTLEILNLLKQLGKQLIFVTNNSTKSRLAYTK 75

  Fly    74 LFAKIGMQVHPEQIWHPAKSIVSYLQS-IKFE---GLIYIIASQSFKTVLREAGFQLLDGPNEFI 134
            .||..|:.|..|||:....:...|::. :|.:   ..:::.........|:..|::.|.|.:..:
Yeast    76 KFASFGIDVKEEQIFTSGYASAVYIRDFLKLQPGKDKVWVFGESGIGEELKLMGYESLGGADSRL 140

  Fly   135 EESYASLAEHIFGKEP---------VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLL 190
            :..:.:      .|.|         |..||..:|..:...::.....||:......:....|...
Yeast   141 DTPFDA------AKSPFLVNGLDKDVSCVIAGLDTKVNYHRLAVTLQYLQKDSVHFVGTNVDSTF 199

  Fly   191 PVAKEVNIVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSF 255
            | .|.....|.|:....|..:|.::|...|||.:.:.:.::..:.: ..|:..|:||.|..|:.|
Yeast   200 P-QKGYTFPGAGSMIESLAFSSNRRPSYCGKPNQNMLNSIISAFNL-DRSKCCMVGDRLNTDMKF 262

  Fly   256 GRQCGF-QTLLVLSGGCSKEELLAETDPQRIPDYYADSVADV 296
            |.:.|. .|||||||..::|..|..:.....|.:|.|.:.|:
Yeast   263 GVEGGLGGTLLVLSGIETEERALKISHDYPRPKFYIDKLGDI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 73/286 (26%)
Hydrolase_6 25..125 CDD:290083 30/103 (29%)
Hydrolase_like 219..295 CDD:289983 24/76 (32%)
PHO13NP_010045.1 HAD_Pase_UmpH-like 24..308 CDD:319813 74/289 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.