DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and PGLP2

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_199587.1 Gene:PGLP2 / 834827 AraportID:AT5G47760 Length:301 Species:Arabidopsis thaliana


Alignment Length:302 Identity:89/302 - (29%)
Similarity:157/302 - (51%) Gaps:13/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVKL 74
            ||.....|:.||.|..:.|.|||:|..|..|...:.....:...||::.|:|||||::..|..:.
plant     6 LSSSNFKSLFDSVDTFLFDCDGVIWKGETLIDGVSQTLDLIRSKGKNVVFVTNNSVKSRRQYAEK 70

  Fly    75 FAKIGM-QVHPEQIWHPAKSIVSYLQSIKF--EGLIYIIASQSFKTVLREAGFQLLDGPNEFIEE 136
            |..:|: .:..::|:..:.:...||:...|  :..:|:|..:.....|:.|||..|.||.:..::
plant    71 FRSLGVTSITQDEIFSSSFAAAMYLKVNNFPKDKKVYVIGGEGVLEELQIAGFTGLGGPEDGEKK 135

  Fly   137 SY---ASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLR-HPECMLIEGATDRLLPVAKEVN 197
            :.   .||.||   .:.|.||::.:|.|:...|:....|.:| :|.|:.|....|.:..:.....
plant   136 AQWKSNSLFEH---DKSVGAVVVGLDPNINYYKLQYGTLCVRENPGCLFIATNRDAVGHMTDLQE 197

  Fly   198 IVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQ 262
            ..|.|...:.:..::.::||.:|||...:.|.|::.:. .:.||:.|:||.|..|:.||:..|.:
plant   198 WPGAGCMVAAMCGSTEREPIVVGKPSTFMMDFLLQKFG-TETSRMCMVGDRLDTDILFGQNAGCK 261

  Fly   263 TLLVLSGGCSKEELLAETDPQRIPDYYADSVADVAQMLGEAP 304
            |||||:|..|:..||.:.:... ||||..:|:|:.::: |:|
plant   262 TLLVLTGVTSESNLLDKGNKIE-PDYYTSTVSDIIKLM-ESP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 81/279 (29%)
Hydrolase_6 25..125 CDD:290083 27/102 (26%)
Hydrolase_like 219..295 CDD:289983 29/75 (39%)
PGLP2NP_199587.1 PLN02645 1..301 CDD:178251 88/300 (29%)
Hydrolase_6 21..124 CDD:290083 27/102 (26%)
Hydrolase_like 218..293 CDD:289983 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4144
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.