DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and PGLP1

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001119316.1 Gene:PGLP1 / 833635 AraportID:AT5G36700 Length:362 Species:Arabidopsis thaliana


Alignment Length:299 Identity:95/299 - (31%)
Similarity:151/299 - (50%) Gaps:13/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PQHILQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTS 68
            |:.:.....|....::||.:..:.|.|||:|..::.|....:....|...||.|.|:||||.::.
plant    61 PRAMATQQLENADQLIDSVETFIFDCDGVIWKGDKLIEGVPETLDMLRAKGKRLVFVTNNSTKSR 125

  Fly    69 EQCVKLFAKIGMQVHPEQIWHPAKSIVSYLQSIKF--EGLIYIIASQSFKTVLREAGFQLLDGPN 131
            :|..|.|..:|:.|:.|:|:..:.:..:|||||.|  :..:|:|..:.....|..||||.|.||:
plant   126 KQYGKKFETLGLNVNEEEIFASSFAAAAYLQSINFPKDKKVYVIGEEGILKELELAGFQYLGGPD 190

  Fly   132 E---FIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLR-HPECMLIEGATDRLLPV 192
            :   .||.....|.||   ...|.||::..|......||....|.:| :|.|:.|....|.:..:
plant   191 DGKRQIELKPGFLMEH---DHDVGAVVVGFDRYFNYYKIQYGTLCIRENPGCLFIATNRDAVTHL 252

  Fly   193 AKEVNIVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGR 257
            .......|.|:....||.::.::|:.:|||...:.|.|.:.:.| |.|::.|:||.|..|:.||:
plant   253 TDAQEWAGGGSMVGALVGSTQREPLVVGKPSTFMMDYLADKFGI-QKSQICMVGDRLDTDILFGQ 316

  Fly   258 QCGFQTLLVLSGGCSKEELLAETDPQRI-PDYYADSVAD 295
            ..|.:|||||||..|...|  |:...:| ||:|...::|
plant   317 NGGCKTLLVLSGVTSISML--ESPENKIQPDFYTSKISD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 91/280 (33%)
Hydrolase_6 25..125 CDD:290083 33/101 (33%)
Hydrolase_like 219..295 CDD:289983 30/76 (39%)
PGLP1NP_001119316.1 PLN02645 56..362 CDD:178251 95/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4144
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.